ELF ­4(üÿòï<œ'!à™‚à@ <œ'!à™Àÿ½'8¿¯4·¯0¶¯,µ¯(´¯$³¯ ²¯±¯°¯¼¯Œ! €Ž!¸ !°À!!¨ !˜…™¥$ ø ! ¼$@…™¥$ ø ! ¼@…™¥$ ø ! ¼$@‚@ &Õ®!`ò®8¿®4·0¶,µ(´$³ ²±°à@½'&Žíÿ@&üÿ&‚…™DŒ¥$ ø !0 ¼âÿÿÿ$…™¥$ ø ! ¼ @$…™¥$ ø ! ¼@$‚ÎÿC …™!  ø ¥$¼@Äÿ$Ãÿ$<œ'!à™Øÿ½'$¿¯ ²¯±¯°¯¼¯°Œ™!€!  ø !ˆ ¼B,…™! @¥$@!0'Ž$¿ ²±° (½'…'Ž! @$¿ ²±°¥$ (½'<œ'!à™àÿ½'¿¯¼¯‚™DŒ ø ¼¿!à ½'<œ'!à™àÿ½'¿¯¼¯‚™CŒ!(€`$dŒ ø ¼B,¿à ½'<œ'!à™°ÿ½'L¿¯H¾¯D·¯@¶¯<µ¯8´¯4³¯0²¯,±¯(°¯¼¯“ ¯qŽ !™ ø ! ¼@s&¢B$¢¯qŽòÿ ¢ˆ@ƒB$¢¯£€!CP$™ ø ! ¼{@! @! !„„$*üÿ@` !°a$  ¯‚QŒB !˜@ ¾àÿã&£¯s&qŽ9 ™ ø ! ¼õÿ@"‚W£íÿC€!V©™!€´!  ø !( ¼™ ø ! #ÂP$¼<’!ˆ ™! 4E& ø ÿÿ&¼ùÿ¢Ö&Ìÿ £s&c$ £¯qŽÞ'Éÿ !°÷&zâ*¶ÿ@¢ @!°!€€™ ø ! ¢Ö&*¼÷ÿ`P&™ ø  $¼!L¿H¾D·@¶<µ8´4³0²,±(°àP½'Äÿ$xÿB$‚…™DŒ¥$ ø !0¼çÿÿÿ$<œ'!à™Ðÿ½',¿¯(´¯$³¯ ²¯±¯°¯¼¯!˜ !€ ! €Ž€™ ø ¼!(™&ñÿ@! € ø ¼îÿ’QŽ' !€`Ž€™ ø !( ¼@& Žóÿ€Ž@™ ø ! ¼@!(@R&QŽÛÿ !€`,¿(´$³ ²±°à0½'™ ø ! €¼îÿR&<œ'!à™Øÿ½' ¿¯±¯°¯¼¯‚!ˆ …™FŒ¥$ ø !€€¼!(™ ø  $¼!8„™„$$ ø 2$¼!8„™„$$ ø ($¼!8„™„$$ ø #$¼!8„™„$$ ø )$¼!8„™„$$ ø +$¼!8„™„$$ ø %$¼!(™ ø  $¼! ™!(  ¿±° (½'<œ'!à™Øÿ½'$¿¯ °¯¼¯™!(¦'$ ø !€€Â¼@!@@ä<£wlB4™! $¦'$bÿÿ$ ø ¼ @!@@¢„B(™„$$!$@!@$¿ °!à(½'‚GŒ ø ¼ôÿÿÿ$<œ'!à™‚!€F!(€„$™ „$„$„$„™!(`„$ <œ'!à™Øÿ½'$¿¯ ²¯±¯°¯¼¯™!€ !ˆ€!À!( ø ˜$¼@0®2®$¿ ²±°à(½'‚$¿ CŒ ²#®°±à(½'<œ'!à™ ¢Œ™!0!(@@!8 àÿÿ$<œ'!à™Èÿ½'0¿¯,³¯(²¯$±¯ °¯¼¯ÐŒ! !˜€¥Œÿÿ$¢ÿÿ$™¦' ø $!€@¼@!0@™¤ ø ¼!00¿,³(²$± °!Àà8½' ±Œÿÿ$õÿ"ÿÿ$…™¥$ ø ! ¼ @$¢¯™! `!( ¦' ø $¼âÿ!€@…™¥$ ø ! ¼@!0îÿ ¯™!  ø ¥'¢¯¢¼C€Îÿ`ÿÿ$ QŽàÿ<œ'!à™Ðÿ½',¿¯(²¯$±¯ °¯¼¯ÐŒ!ˆ .!€…™¥$!  ø $¼@!  ¯™ %Ž! @¦' ø $¼!€@!,¿(²$± °à0½'…™¥$ ø $¼&@$…™¥$!  ø $¼(@! $Þÿ¢¯™¥Œ¦' ø $!€@¼Þÿÿÿ$¦Â,@‚E$„™ ø „$¼Îÿ!Ãÿ¢¯ƒ€pc$!CDŒ! œ€…™¥$ ø $¼ @$…™¥$!  ø $¼@! $¦ÿ¢¯¤ÿ¢¯‚ÕÿE$‚ÒÿE$‚ÏÿE$‚ÌÿE$‚ÉÿE$™¥' ø !0¢¯¢¼C€Šÿ`ÿÿ$‘ÿ<œ'!à™¸ÿ½'@¿¯<µ¯8´¯4³¯0²¯,±¯(°¯¼¯Ñ$&Ž!¨€!  rÀ!€! c$bŒüÿ@&j! À™ ¥' ø !0!˜@ ¢¼C€L`ÿÿ$. ¯@ ¯…2Ž™¥$ ø ! @¼]@$…™¥$ ø ! @¼Y@$¢¯.@…1Ž™¥$ ø ! ¼J@$…™!  ø ¥$¼"@ÿÿ$$¢¯£ÿÿb2%b$£¯$ ¢@™…Ž!  ¦' ø $!€@¼@! @„™¥— ø „$¼! @¿<µ8´4³0²,±(°!€àH½'™ …Ž!  ¦' ø $¼íÿ!€@ÿÿ$@¿<µ8´4³0²,±(°!€àH½'¬ÿ¢¯Àÿ¢¯™! @ ¥' ø !0¢¯ ¢¼C€žÿ`ÿÿ$Ñÿ<œ'!à™¨ÿ½'P¿¯L·¯H¶¯Dµ¯@´¯<³¯8²¯4±¯0°¯¼¯Ñ$&Ž!°€!¨ !¸À!€! c$bŒüÿ@&y! À™(¥' ø !0! @(¢¼C€V`ÿÿ$.S@(¥'™$Ž ø !0!˜@(¢¼C€H`ÿÿ$.@$ ¯…2Ž™¥$ ø ! @¼a@$…™¥$ ø ! @¼]@$$¢¯.@$… 1Ž™¥$ ø ! ¼N@$…™!  ø ¥$¼@ÿÿ$$$¢¯$$$$¢ @¥Ž™! À´¯ ³¯¦' ø $!€@¼@! @„™¥ ø „$¼! P¿L·H¶Dµ@´<³8²4±0°!€àX½' ¥Ž™´¯ ³¯·¯! À¦' ø $¼èÿ!€@ÿÿ$P¿L·H¶Dµ@´<³8²4±0°!€àX½'¨ÿ$¢¯¼ÿ$¢¯™! @(¥' ø !0!¸@(¢¼C€šÿ`ÿÿ$Êÿ<œ'!à™Àÿ½'<¿¯8´¯4³¯0²¯,±¯(°¯¼¯Ò$QŽ! €!˜  !€!@c$bŒüÿ@& ¯  ¯…™¥$ ø ! ¼A@$¢¯. @…QŽ™¥$ ø ! ¼F@$¢¯$£`$™ eŽ! €¦' ø $¼!€@! <¿8´4³0²,±(°!€à@½'£$Gb¦'™eŽ! € ø $!€@¼ëÿ@! @¦„™eŽ!8À„$ ø ÿÿÆ0¼àÿ! …™¥$ ø ! ¼¹ÿ@$…™¥$ ø ! ¼@$°ÿ¢¯…™¥$ ø ! ¼´ÿ@$…™!  ø ¥$¼¾ÿ@ÿÿ$ªÿ$™!  ¥' ø !0¢¯ ¢¼C€’ÿ`ÿÿ$®ÿ„™ ø „$¼¦ÿÿÿ$<œ'!à™Ðÿ½',¿¯(²¯$±¯ °¯¼¯!ˆ             !€$™¥' ø $£! ‚ bc$¼! `&@£¯ñÿ:,¿(²$± °B,à0½'<œ'!à™Èÿ½'0¿¯,±¯(°¯¼¯™ÂŒ! !ˆ ™ $¦'¥'@!€€%Ž!È` ø ¼!@„™@„$¥ ø ¼!0¿,±(°!`à8½' ø ! @¼! ™¦' $òÿ@ÿÿ$%Žâÿ<œ'!à™Èÿ½'0¿¯,µ¯(´¯$³¯ ²¯±¯°¯¼¯‚€$P$@¬®!ˆ ‚¥Œ˜U$!˜€@$1 ÿÿ$™!0 ø  $¼*@!@@£–rS$0b¸$@!€”“!ˆ %– ø „&*¼`1&2!(™&ôÿ@d& ø ¼%–™ ø „&*¼ïÿ`1&™ ø  $¼!0¿,µ(´$³ ²±°!`à8½'®™%Ž! `!0 ø  $Ü$¼ÇÿA!@êÿ<œ'!à™°ÿ½'L¿¯H¾¯D·¯@¶¯<µ¯8´¯4³¯0²¯,±¯(°¯¼¯!¸ …™!ð€ÄŒ¥$ ø Ñ$¼$Ž–C,! Õ&5€ÿÿ$1&>`!€"Žž@ ¥'™ ø !0!ˆ@¼ªU$ªU$®‚±®DŒ 接¯…™0&!8¥$ ø ±¯¼ 厙!8! À ø Æ&¼‡@!€@‚™DŒ ø ¼€!™ ø ! €¼!L¿H¾D·@¶<µ8´4³0²,±(°àP½'"Ž%@…™ ø ¥$¼–@! @™¤&$¹$ ø !8@¼! €™ ø !ˆ@¼B@!(@™ ø ! €¼x@¸$b"€$O"!(©ÿ ®™ ¥' ø !0® ¢¼C€K`!˜"Ž1&@!@¥Ž¢0V@@ˆ!±¹B,‘ÿ@„™ ø „$¼Ÿÿ÷ÿ$™@€! @ ¥' ø !0!€¦ ¢¼C€(`s&"Ž1&ïÿ@!@Üÿ„™„$ ø !0@¼ƒÿýÿ$„™ ø „$¼{ÿýÿ$„™„$ ø !(@¼sÿ„™„$!(@ ø !0 ¼jÿúÿ$„™„$ ø !(@¼bÿùÿ$H£–rS$žÿb!(„™„$ ø !(@¼Vÿûÿ$„™ ø „$¼Nÿøÿ$„™„$ ø !(@¼Fÿüÿ$‚…™DŒ¥$ ø !0@¼Jÿþÿ$<œ'!à™¸ÿ½'D¿¯@¾¯<·¯8¶¯4µ¯0´¯,³¯(²¯$±¯ °¯¼¯L¥¯™¥Œ!˜À$¦' ø H¤¯¼!¨!¸!°ä&f@!@s&bŽŽ@-$C€+$†d!@„~ÿÿ$™! @¥' ø !0!€@¢¼C€]`Ž!ˆ! !”™DŒ1& ø !(@À ¼L@!”pŒôÿ!”’„™GŽ„$$ ø E$¼GŽ„™„$$ ø 2$Ž¼!!ˆ“– ! DŽgŒ ø 1&À !”!¨PŒ¼!”™e&ñÿ!0DŽfŒÅ& ø 1&À !”!¨PŒ¼ñÿ!”™EŽ ø  $¼!D¿@¾<·8¶4µ0´,³(²$± °!`àH½'¸ÿbŽC€~%¸ðs&bŽ†ÿ@¦'£L¹'$C %%W™H¤¢¯ ø $¼Øÿ!@}ÿR$êÿ%°Ð„™¥ ø „$䎼!ˆ€’¢$P@™D&%Ž ø ¼1&!¨0Žïÿ™ ø  $¼±ÿ!<œ'!à™àÿ½'¿¯°¯¼¯…™¥$ ø !€€¼! …™¥$ @! ø ¼! ™@ $ ø ¼@¿°!`à ½'<œ'!à™Àÿ½'<¿¯8°¯¼¯!€…b$B,¤$ég(@°'¢Œƒª™º!  ø ££¼<¿8°à@½'…Â!0`!@b™¥$! àc0‚C0`G$…™¥$ ø ! ¼™ ø ! ¼<¿8°à@½'‚…™G$¥$ ø ! íÿ ø ¼êÿ<œ'!à™Èÿ½'0¿¯,µ¯(´¯$³¯ ²¯±¯°¯¼¯•“!€±&!€:$!P™e&4¢1&F!  ø &*¼óÿ`!ˆ"¢&0¿,µ(´$³ ²±°à8½'<œ'!à™Ðÿ½'(¿¯$±¯ °¯¼¯™ÂŒ¦'! !ˆ ™$!(À@!€€%Ž!È` ø ¼¤'™@!@ ø ¼™ ø ! @¼!(¿$± °!`à0½' ø ! @¼! ™¦'$@ÿÿ$ %Ž ø ¼!@(¿$± °!`à0½'<œ'!à™Èÿ½'0¿¯,µ¯(´¯$³¯ ²¯±¯°¯¼¯‚™S$!€ !À!( $!¨€! `H´ ø !ˆà¼!(™ ø ! `¼™ ø ! ¼B$™!(@!0  ! S™“®!  !0`0¿,µ(´$³ ²±°$ $ 8½' ø ¼“®™!  !0`0¿,µ(´$³ ²±°$ $ 8½'<œ'!à™Àÿ½'8¿¯4³¯0²¯,±¯(°¯¼¯ÂŒ @ÿÿ$!@8¿4³0²,±(°à@½'™¥Œ ¢'!0!8¢¯Ì#9' ø   ¯¼íÿ@!@ ±"Ž@@!€“!™F€!( ø d&#Ž&+¼öÿ`!™ ø  $¼!@8¿4³0²,±(°à@½'„™ ø „$¼òÿ!@<œ'!à™Øÿ½' ¿¯±¯°¯¼¯ƒ‚fŒP$ªF¸™¥Œ!0 ø  $¼! …™¥$!@@$ ø ¼! …™@¥$$„™„$ ø !( ¼! ¿±°!`à(½' ø ¼ïÿ@íÿ$<œ'!à™Ðÿ½',¿¯(´¯$³¯ ²¯±¯°¯¼¯’ÂŒ!˜€™P&!ˆ &@! @™€ 9' ø ¼%Ž™D& ø !€@¼™ ø D&¼F&ƒ™‘c$!CP¨P¸ %ŽB$! `,¿(´$³ ²±°#8F 0½'¥Œ ø ! ¼%Ž™! `!0 ø  $¼@!@™DŽ !9' ø ¼!,¿(´$³ ²±°!`à0½'<œ'!à™ ÿ½'\¿¯X¾¯T·¯P¶¯Lµ¯H´¯D³¯@²¯<±¯8°¯¼¯‘™!  ¥Œ!¨€ ø $&¼…Ž™!  && ø  $¼S@!@0&ŠŠ ŠŠŠŠš šš"šššŠ£¯š$¥¯(¦¯¢¯ ¤¯,§¯„™0¨¯ ø „$¼¥ž™ ø Ä'£¼;`„™ ø „$¼¥™ ø Ä'£¼`„™.¥— ø „$¼0¥—„™ ø „$¼2¥—„™ ø „$£¼úÿs$m`0&™ ø  $¼!\¿X¾T·P¶LµH´D³@²<±8°!`à`½'„™$¥— ø „$¼&¥—„™ ø „$ ¢²B0¼:@üÿS&³ÿ`!0ƒ™b$dŒEŒCŒ G Hª ªª$ºº ¢º ¢…Ž!   ø  $¼Éÿ@!@„™ ø „$!¼“ÿ`$—–+pŒÿ@™E’ ø ä&¼2™&Ä&óÿ@R& ø ¼ïÿ+p™ ø (¤'¼!(@„™ ø „$¼ºÿöÿS&ƒb$dŒEŒCŒ F GHª ªª$ºº ¢ ¢º¢™…Ž!  !0 ø  $¼€ÿ@!@„™ ø „$!¼qÿ`$”‘+pjÿ@™E’ ø „&¼2™&$&óÿ@R& ø ¼ïÿ+p<œ'!à™Èÿ½'4¿¯0¶¯,µ¯(´¯$³¯ ²¯±¯°¯¼¯!€„™!ˆ  ø „$¼ !€–•”“!PC™b0g0&d&B( @€c0àÆ&¦&`‡&§& ø +¼ìÿ`!P™4¿0¶,µ(´$³ ²±°]$ 8½'<œ'!à™¸ÿ½'D¿¯@¾¯<·¯8¶¯4µ¯0´¯,³¯(²¯$±¯ °¯¼¯™!˜ $!( ø ! €cŽ¼s&!`E`!¸„Ž•–žÿ‚,e@! @™¥' ø !0°¼g@ˆ™! ¥& ø $¼@&1&°¯ƒ‚dŒ@&°¯‚@!DC” c0öÿ`™!  ø Å&¼@! ™ ø Å'¼@€16‚Ž!TB$q ‚®! @bŽs&Áÿ@!@!àD¿@¾<·8¶4µ0´,³(²$± °àH½'‚åÿ@!0‚…DŒ™¥$ ø !8@¼ÿÿ$!àD¿@¾<·8¶4µ0´,³(²$± °àH½'‚…DŒ™¥$!0@ ø ÿ$èÿ‚…™DŒ¥$ ø !0@¼àÿÿÿ$<œ'!à™Èþ½'4¿¯0´¯,³¯(²¯$±¯ °¯¼¯™²'Ñ$! €!˜ ! @!( ø $0Ž¼"! €…™¥$ ø ! ¼ @! …™ ø ¥$¼.@!(  eŽ™! €!0@ ø $¼!€@!4¿0´,³(²$± °à8½'™eŽ!0@ ø $¼ðÿ@!€@™¥ ø ¤'¼™ ø  $!¼4¿0´,³(²$± °à8½'™œ-9' ø ! @§¼!@à! €!(C¢c$F0÷ÿA+ g$ôÿ¦  ‚…™DŒfŽ ø ¥$¼ eŽ™! €°ÿ¦'<œ'!à™Àý½'8¿¯4³¯0²¯,±¯(°¯¼¯Ñ$"Ž@!˜€™r$¦' ø $¼ @!€@™¥ ø ¤'¼™ ø  $¼!8¿4³0²,±(°à@½'™ ²'G$!0@ ø $¼ðÿ@!€@…0Ž™¥$ ø ! ¼)@! …™ ø ¥$¼.@!( ™œ-9' ø ! @ ¤¼ €!(¨'! C€`+¤¥$+¤ùÿ@!+¤@$‚„GŒ™„$1$ ø ÿÿ$¾ÿ ¦ À!(¨'€ÿ$! C¥$%ã+ ¦úÿ€ C ™! `!0@H$ ø $!€@!¼8¿4³0²,±(°à@½'<œ'!à™Àÿ½'<¿¯8¶¯4µ¯0´¯,³¯(²¯$±¯ °¯¼¯™–$!ˆ€! €¬ € !(! À ø €$ ¢ ® ¢DŽ¼b€!¨4Ž 0’‚&"®R&/!˜€…™ ø ¥$¼(@ÿ2$ 0¢DŽM€‚&!˜€"®$!€` "¢ ! ™¥' ø !0£”"®b€¼M@$0®$=¢?$! <¿8¶4µ0´,³(²$± °à@½'ÿ2áÿ@$…™¥$! ` ø $¼4@! `™ ø =$¼V@!€@#SþÿF$@Ã(`?$™! À ø e&‚¼Åÿ`&‚…DŒ™&Ž¥$ ø !8`¼Çÿ$ÿÿ$$Çÿ¢! ?$"¢<¿! 8¶4µ0´,³(²$± °à@½'³ÿ"¢b’ÓÿB$@$p’™0¢ ø ! `B,¼@™.$Ž ø .¼ÿ@!€DŽ€!€€"ŽB$ˆÿ"®!€`…ÿ "¢‚…DŒ™&ŽÀÿ¥$‚…DŒ™&Ž¹ÿ¥$‚…DŒ™&Ž²ÿ¥$<œ'!à™8ÿ½'À¿¯¼³¯¸²¯´±¯°°¯¼¯™À¬!€€à¬¤'!ˆÀ!0!à ø !˜ ¼¤'™ ø !(!@ÿÿ$¼-b! %¢“)@$'bÿÿ$'£ƒC$b(°'…™¥$ ø ! ¼@…™¥$ ø ! ¼ @! …™ ø ¥$¼ @! &¢“@ £¬¢"®C®! À¿¼³¸²´±°°!€àȽ'‚…DŒ™¨§¥$ ø !0`¼îÿÿÿ$<œ'!à™Èÿ½'0¿¯,±¯(°¯¼¯™ÂŒ!@  $™¦'!€ '@!ˆ€¥Œ ¯ ¯ ø   ¯¼,@!@„ ¢™-@„$„ ø „$¼¥„™ ø „$¼¥„™ ø „$¼!0¿,±(°!`à8½'!È ø ! @¼ Ž™¢¯! ¦' ø $¼!@0¿,±(°!`à8½' ø ¼ ¥„™ ø „$Íÿ<œ'!à™Èÿ½'0¿¯,³¯(²¯$±¯ °¯¼¯!˜ !€.$$™¥' ø !0£! ‚ b€c$¼! `&R£¯ñÿ:0¿,³(²$± °B,à8½'<œ'!à™Øÿ½'$¿¯ °¯¼¯ƒ‚…†‡™¢¯£¯& ø ¥$&¼$¿ °à(½'<œ'!à™Àÿ½'8¿¯4·¯0¶¯,µ¯(´¯$³¯ ²¯±¯°¯¼¯!Â(!À!¸€!  @!€€ $@!ˆ–•\$!‘G"ó@ÂŽ™!bC”!0à@c0! `¥&¢&1&*2îÿ@!‘#¢8¿4·0¶,µ(´$³ ²±°à@½' ø 1&¼ìÿ!€¢æÿ&<œ'!à™Àþ½'<¿¯8¾¯4·¯0¶¯,µ¯(´¯$³¯ ²¯±¯°¯¼¯!˜ J !ð€¶'!€À3 !ˆ—´,$!Ñ™F!  ø å&¼1&™¤'U!€+3 @22ðÿ@!Ñ‚™! !0 éÿ€E$ ø ¼!€!Ñ™F!  ø å&¼1&™¤'åÿU!€ ø !€À+3¼ãÿ@22Ð! À™ ø ¼<¿8¾4·0¶,µ(´$³ ²±°à@½'™ïÿ $<œ'!à™Ðÿ½',¿¯(²¯$±¯ °¯¼¯ÐŒ!ˆ +!€…™¥$ ø ! ¼@ÿÿ$¢¯™ %Ž! @¦' ø $¼!@,¿(²$± °!`à0½'…™¥$ ø ! ¼/@! …™ ø ¥$¼êÿ@ÿÿ$ßÿ$™¥Œ¦' ø $¼àÿ@!@£ÿÿ$#b`$b„™„$ ø ¼™ ø  $¼!,¿(²$± °!`à0½'ºÿ ¯„™êÿ„$„™æÿ„$„™âÿ„$<œ'!à™Ðÿ½',¿¯(²¯$±¯ °¯¼¯ÐŒ!€¥Œ+ ÿÿ$™¦' ø $¼$@!@„™¥ ø „$¼!,¿(²$± °!`à0½' ±Œ ÿÿ$…™¥$ ø ! ¼@<™¢¯! @!( ¦' ø $¼!@,¿(²$± °!`à0½'…™¥$ ø ! ¼@<æÿB4™ ø ! ¼ßÿ<œ'!à™Ðÿ½',¿¯(²¯$±¯ °¯¼¯Ð$Ž!€™!ˆ ! @@ÿÿ$ ø ¢¯¼Ž™ÿÿ$ @! @ ø ¼ %Ž™¢¯! @¦' ø $¼!@,¿(²$± °!`à0½'<œ'!à™hÿ½'”¿¯¾¯Œ·¯ˆ¶¯„µ¯€´¯|³¯x²¯t±¯p°¯¼¯…!°à¢$£ŒG”$îÿÿ$$ÿÿ$(Ǧ*¢+â8Ä®,Ä®0Ä®4Ä®<À®Þ$Ð` ¯h ¯pd ¯@Â&l¢¯‘™!  ø %&¼&@$d¢¯Ð`™¤'!( ø @$d¢¼Þ'!˜!èÿ@! !¨$  !  ™X¥' ø !0`¢¯X¢¼C€`s$$s$ B…™¥$ ø ¤'¼@`t$™ ø !  !0@!B,¼U@Ä&™Æ® ø !( ¼t$ B…™¥$ ø ¤'¼ @‚™!   ø E$¼Í@!  +À¢…™¥$ ø ¤'¼@b$…™¥$ ø !  ¼ @…™¥$ ø !  ¼š@*À¢b$ B…™¥$ ø ¤'¼@n$™!   ø $Å&¼7@n$ B…™¥$ ø ¤'¼@a$€`¢,®a$ B¤'‚™ ø E$¼@p$€`¢0®p$ B¤'‚™ ø E$¼@h$ý€`¢4®h$ B…™¥$ ø ¤'¼@c$߀`¢8®c$ B…™¥$ ø ¤'¼=ÿ@  ÿÿ$¢‚!ˆ @! —l²™! \¥' ø !0¼\°!˜@™å&¡!  ø !ˆP@$¼¥‚S¦"‚”&éÿ@R&!0€ÿÿ$ÿÂ<Æ®‚„™GŒ„$$ ø $ÿÿ$¼h¢¯h¢”¿¾Œ·ˆ¶„µ€´|³x²t±p°à˜½'…™¥$ ø !  ¼Z@$…™¥$ ø !  ¼R@$…™¥$ ø !  ¼¼@$Oÿ*¢‚™ ø E$¼–@$,ÿ+¢™%&!  ø $¼"@! ™ ø =$¼Œ@!ˆ@#PþÿF$@Ã(`?$™¤' ø &#‚¼Òþ`5&‚…DŒ™¥$!0 ø ¼ÿÿ$§ÿh¢¯’ÓÿB$Àþ@!¨™ ø ! B,¼‚k@Än€!¨€²þÞ'ÿ*¢<ÄŽÿ€!c$*dýÿ@h¢”¿¾Œ·ˆ¶„µ€´|³x²t±p°à˜½'‚…™DŒ¥$!0  ø !8 ¼cÿÿÿ$‚…™DŒ¥$õÿ!0€‚…DŒ™¥$!0  ø ¶ÿ‚…DŒ™¥$öÿ!0 ‚…DŒ™¥$ïÿ!0 ‚…DŒ™¥$èÿ!0 ‚…DŒ™¥$áÿ!0 ‚…DŒ™¥$Úÿ!0 ‚…DŒ™¥$Óÿ!0 ‚…DŒ™¥$ƒÿ!0‚…DŒ™¥$|ÿ!0‚…DŒ™¥$uÿ!0‚…DŒ™¥$·ÿ!0 <œ'!à™Èÿ½'0¿¯,³¯(²¯$±¯ °¯¼¯™!€À$!˜  ø !€À¼!ˆ@™! ! !(™) À$!È@ ø ¼À$™!0! @A9'!(`!8  ø ¢¯¼!€@™! @@!0 ™ ø ! ¼!0¿,³(²$± °à8½'<'Ž eŽ@8 ø @ç$¼ìÿ!€@‚…DŒ ø ¥$¼êÿÿÿ$<œ'!à™‚!(F$`Æ$ÂŒ¥$ûÿD.£(ÂŒàà!¢( @!8€à!#¤þÿE$! ä£( `‡$âäøÿF#¤‚$*¢óÿ@!àà!à<œ'!à™™ ¢,þÿ¥$©,À¬À¬À¬ À¬À¬3@$‚ƒ!Cüÿ¥$£,¤‡$) !@Ǭ&`ç$âã!CÿÿB0€# £b$+¢þÿ…$!Hg$@£,Ǭ!@`'%ã"‘!bÿÿb0€# ¢C$+£þÿ…$!HG$`¢, Ǭ!@@'%Ǭà!$ ‚$€$$‚$$‚$!à!`<œ'!à™ ÿ½'\¿¯X¶¯Tµ¯P´¯L³¯H²¯D±¯@°¯¼¯ƒ0$b ¦'ƒ…ˆb$™Hˆg”„$üÿ¥$8§§0K9' ø :¨£¼! @$ £—b\¿X¶TµP´L³H²D±@°à`½'ƒ™Œb$GŒb”…„$8¢§0K9' ø :§£¼ãÿ$+€„™„$ ø $¢¼)@(£`,£µ`0£f`€‚E$„™ ø „$¼\¿X¶TµP´L³H²D±@°à`½'„™Öÿ„$‚êÿE$„™ ø „$¼$°•! K¹&8¥' ø $¼k@’b,O@€ƒc$!CDŒ! œ€„™ ø „$¼³ÿ„™ ø „$÷ÿ„™ ø „$ðÿ„™ ø „$éÿ„™ ø „$âÿ„™ ø „$Ûÿbc„!CÿÿP0™„$ ø !(¼€22.@‚E$„™ ø „$¼2ü@‚E$„™‘ ø „$ 2(L9& ø ‚ !(@B,¼è@‚F$„™ ø „$¼ó€(L9&02 ø !!(@B,¼è@‚F$„™ ø „$¼\ÿbc„!CÿÿS0™„$ ø !(`¼7`!•8¶'Kµ&’ÿÃ0¦bb(›@$©b%€‚E$„™„$ ø ÿÆ0R&*S¼@,¢€!ˆC0&! !(À!È  ø $¼Ýÿ@$’„%’’’™¢¯ ø „$æÿR&‚ÝÿE$™ ø  $¼ÿbc„!CÿÿS0™„$ ø !(`¼'`!•8¶'(£€!ˆb0&K¹&! !(À ø $¼@@’ÿÃ0b,.@€ƒ¨c$!CDŒ! œ€„™„$ ø R&*S¼Ýÿ@™ ø  $¼Åþ„™ðÿ„$„™ìÿ„$„™èÿ„$„™äÿ„$„™àÿ„$€‚E$„™„$ ø ÿÆ0ÖÿR&’„%’’’™¢¯ ø „$ËÿR&‚ìÿE$gÿ`„™ ø „$kÿR&„™ ø „$dÿR&„™ ø „$]ÿR&‚ÿF$‚ÿE$%€‚E$„™’ ø „$¼iþ‚ÿF$™ ø  $¼vþ„’’’’™¢¯ ø „$¼Sþ‚ÔþE$‚ÝÿE$<œ'!à™Øÿ½' ¿¯±¯°¯¼¯!€ $ !ˆ€$?¢†Â$+¢ @…„™ ø „$0’¼.@5$’+ @#(„™ ¿±°„$ (½' ¿±°à(½'…„™„$ ø þÿ&.¼ãÿ@„™„$ ø ¼Ýÿ$&™ ø !(¼Öÿ…„™ ¿±°„$ (½'„™èÿ„$<œ'!à™(ÿ½'Ô¿¯Ð¾¯Ì·¯È¶¯Äµ¯À´¯¼³¯¸²¯´±¯°°¯¼¯ƒŒk$™b!€™F’ ¤' ø E&¼ ¥'„™ ø „$C–$c0¼¤b$¯b‚E$„™ ø „$¼NE†„™ ø „$¼PE‚„™ ø „$¼HE’„™ ø „$¼™ ø D&¼!(@„™ ø „$¼„™ ø „$C–¼b0F@b0:@b0.@b0"@b0@ b0 @@b0þ@€b0ò@b0æ@ b0Û@™ ø  $¼„™ ø „$¼4EŽ™ ø 8D&¼™ ø  $xSŽ¼@`!(`tB–!¸R‚¨·¯¬³¯! à´J^$¨µ'–¬´'0’. @™K9' ø ¼ @$ÿ2£Ž! ‘‚Ž„$#ƒ#C‚®!¤®`¨¤¬¥!ÈÀ ø Ý$!ˆ@¼D$ÀÅ&Ýÿ@$‚! à!(`´JY$ ø 0$¼@™`L9' ø ! @¼CŽk$bQB’@™ ø  $¼Ô¿Ð¾Ì·È¶ÄµÀ´¼³¸²´±°°àؽ'„™ ø „$HD– $ðƒ0¼ãb‚E$ ƒ0 $ÿ†0b($$b$ $ÿÿ‚0„™„$ ø ¢¯¼XE’„™ ø „$¼„™ ø „$TCŽ¼c0Ã`„™‘ ø „$¼!€€*@™!($&±!Ã!0RdÃÀ#Cc0ðÿ`& ø €*¼íÿ@„™ ø „$¼™ ø  $¼Ô¿Ð¾Ì·È¶ÄµÀ´¼³¸²´±°°àؽ'„™ ø „$¼ÿ„™ ø „$¼C–ÿ b0„™ ø „$¼C–ÿb0„™ ø „$¼C–üþ€b0„™ ø „$¼C–ðþ@b0„™ ø „$¼C–äþ b0„™ ø „$¼C–Øþb0„™ ø „$¼C–Ìþb0„™ ø „$¼C–Àþb0„™ ø „$¼C–´þb0Hƒb,@+d4d4TCŽ™X$F’xC®HD¦E& ¤' ø tB¦¼ ¥'„™ ø „$C–$c0¼^þb$‚`þE$÷þ ™`L9' ø ! ¼ïþ‚SþE$‚ÿE$Oÿ&„™ ø „$¼7ÿ<œ'!à™Èþ½'4¿¯0´¯,³¯(²¯$±¯ °¯¼¯@$¢¯™¥Œ³'!0` ø $¼@! @¢ @!ˆ’°'™Ž ø D&cŽ1&+#¼÷ÿ`&™ ø  $¼!€4¿0´,³(²$± °à8½'<œ'!à™ÿ½'ô¿¯ð¾¯ì·¯è¶¯äµ¯à´¯Ü³¯Ø²¯Ô±¯Ð°¯¼¯‚—ÈCð&™°££!ˆÀø¤¯!(!  $± £² £ ø ³ £¼1&ƒ™b$dŒEŒC Fªª¢äºº ¢ ø ! #Ž¼P$!!¨``!°‚™B$EŒ¤' ø !0¼$ÿÿ$$™¤' ø !( ¼%T?Sb$'¥“ ¢&€&‰ƒ!ˆ"w$”bc$çÿb¨¥· ™°¤' ø $¼´ £™¤' ø !( ¼ÝÿTŽÀ' ñ&‚…DŒ‚™B$FŒ ø ¥$¼Àÿÿ$‚…DŒ™¥$‚B$FŒ ø ¼ÿÿ$ô¿ð¾ì·è¶äµà´Ü³Ø²Ô±Ð°àø½'ñ&™!&! °¥'$& ø R¤!˜¼d$b®™ø¤”&$ ø !0 !¨@¼Ýÿ !˜ ‚CŒ`!ˆ–¸´'p&–™! @ ø !(€¼!0@™Ä& ø !(€cŽ1&+#¼ðÿ`&™ ø  $! ¼ô¿ð¾ì·è¶äµà´Ü³Ø²Ô±Ð°àø½'&¢“#@¬§þ$?â R6$w$oÿb&¢“"@¬§$â($)â R6bÿ$R6íÿ$R6\ÿ$€ÿ rÿ‚…DŒ™¨§¥$‚B$FŒ ø ¼|ÿÿÿ$‚…DŒ™¨§ñÿ¥$‚…DŒ™gÿ¥$‚…DŒ™åÿ¥$‚…DŒ™ßÿ¥$<œ'!à™Èÿ½'0¿¯,µ¯(´¯$³¯ ²¯±¯°¯¼¯’ $S&B® `®Ñ$0Ž!¨€W!  ™ ø ! þÿB$B,¼D@!(™ ø d&0Ž¼Q$…™¥$ ø ! ¼ @$…™¥$ ø ! ¼J@$b®™…ŽF&!   ø  $!@¼@ bŽ @!ˆ”p&™Ž ø „& cŽ1&+#¼÷ÿ`&™ ø  $¼!@0¿,µ(´$³ ²±°à8½'‚…DŒ™¥$ ø !0¼îÿÿÿ$‚„GŒ™„$$ ø $¼ãÿÿÿ$‚„GŒ™„$ ø  $õÿ‚…DŒ™¥$ ø !0áÿ<œ'!à™Ðÿ½'(¿¯$±¯ °¯¼¯ÂŒ!€ @!ˆ€™¥Œ¦' ø $¼&@! @¥¢,T@€ƒÌc$!CDŒ! œ€™! @¥' ø !0¢¯!(@¢¼C€ `ÿÿ$¢,@¦'™ Ž!  ø $¼! @(¿$± °!€à0½'„™ ø „$¼! (¿$± °!€à0½'„™ ø „$¼óÿ! „™ ø „$¼ëÿ! „™ ø „$¼ãÿ! „™ ø „$¼Ûÿ! „™ ø „$¼Æÿÿÿ$<œ'!à™ ÿ½'Ø¿¯Ô±¯Ð°¯¼¯™¦'$$ ø !€€¼ˆ$™„ƒ!@ „$™f$@ $ $!  ø b¬¼!€@„l$”‚Œ…!0@•ÿB$B,™¥$-@”„$™´U9' ø ¼!ؿԱаàà½'!È ø ¼! ™$$$ ø  ¦'¼H±'™!€@! ! ™$¥' ¦!È@ ø ¼!( „™ ø „$Úÿ‚DŒ ø Óÿ ø  $!¼Ø¿Ô±Ð°àà½'<œ'!à™Àÿ½'8¿¯4³¯0²¯,±¯(°¯¼¯Ð$™Ž±'!8 !€!˜ ™$! @@!( ‚„GŒ„$$ ø ¼8¿4³0²,±(°ÿÿ$à@½'!Èà ø ¼$„™„$#@$™Ž! !(!0™! @ @$!0  ø $¼8¿4³0²,±(°à@½'!È` ø ! @¼ eŽ™¢¯! @¦' ø  $¼ìÿ‚GŒÅÿ<œ'!à™ÿ½'l¿¯h²¯d±¯`°¯¼¯ÐŒ!ˆ€™! ! ÿÿ$ ø ¼!@™!0@øÿB$9B,!H !(¤'™@@$$!È £§ ø ¢§¼ EŽ™! ¦' ø D$¼l¿h²d±`°àp½'‚…DŒ¥$ ø $¼òÿÿÿ$<œ'!à™¸ÿ½'D¿¯@¾¯<·¯8¶¯4µ¯0´¯,³¯(²¯$±¯ °¯¼¯ƒ!€b$d”PŽF™¤§¦£!  ø !˜ ûÿC$>b,¼&@q&€ƒàc$!CDŒ! œ€…™! ¥$ ø $¼@&™ ø ! B0f®‚¼@ $*Â$Â,‰@$$$Â$D¿@¾<·8¶4µ0´,³(²$± °ÿÿ$àH½'™!(¤' ø $¼¤'™!( ø $"¢&‚¼ðÿ@1&fŽ $ÚÿÂÂ,$pb®tbŽR&B4tb®PŽ>$‘•–$ ýÿ$tbŽ$Wtb®R&PŽ/™$&!( ø $¼@bŽFT™¤&!( ø $¼@bŽ<T$™Ä&!( ø $¼Øÿ@! ™ ø œe&¼Õÿ@œ`® `¦R&PŽÓÿD¿@¾<·8¶4µ0´,³(²$± °!àH½'™ ø ! ¼F$™b®!  ø !(¼fŽœÿ $ÿÂ$ $wÿÂ$™ÿpb®©ÿp~®§ÿpb®<œ'!à™Èÿ½'0¿¯,³¯(²¯$±¯ °¯¼¯ÂŒ!€!ˆ "@!˜!€™%Ž! @°¯¦' ø $¼@ÿÿ$¢"@&*ïÿ@„™ ø „$¼!`0¿,³(²$± °à8½'™ ø ! @¼ %Ž™¢¯! @¦' ø $¼êÿ!˜@„™„$ ø !(¼ãÿ!<œ'!à™Ðÿ½',¿¯(´¯$³¯ ²¯±¯°¯¼¯‚™S$!€ !ˆÀ!( $! €! ` ø !à¼!(™ ø ! `¼™ ø ! ¼P$™!( !0@@! ™!8! €!0`,¿(´$³ ²±°$ 0½' ø ¼!8™! €!0`,¿(´$³ ²±°$ 0½'<œ'!à™ ÿ½'Ø¿¯Ô³¯Ð²¯Ì±¯È°¯¼¯™!€À!€¤$¤'!˜ À ¯ ø !(¼&…™¥$À¦'ħ' 79' ø ! ¼@!(@ı™€!€Žÿÿ$&`! ` ø Ž¼´¥'™! ``¢¯…™! @¦'¤$ ¥$ eŽ ø ¼!(@ؿԳв̱Ȱ! àà½'™! @¦'øn9' ø ¤$¼ðÿ!(@ ø ¼ëÿ@ÿÿ$ıÜÿ<œ'!à™¸ÿ½'D¿¯@¾¯<·¯8¶¯4µ¯0´¯,³¯(²¯$±¯ °¯¼¯Ñ$"Ž!ð L@H¤¯™! @¥' ø !0!€@5Ž¢¼‚¢!˜ÿÿ&B,=@1&"Ž‘@™ ø ¨$¼S$™! `!(¤$P¬ ø !@¼$Ž™ ø  E&¼ @ `¦œ`®™$Ž ø ¼B® Å™H¤!0@ ø ¨$¼D¿@¾<·8¶4µ0´,³(²$± °àH½'ŽÌâ&!BCŒÂÿ`ÿÿ&”„—™‡Ž„$$ ø >$ÌðŽ¼ÿÿ$"!˜•–Ìñ& !„ŽgŒs& ø À!Q! PŒ¼!Q™¥&ñÿ!0„ŽfŒs&Å& ø À!Q! PŒ¼ñÿ!Q™…Ž ø  $¼!D¿@¾<·8¶4µ0´,³(²$± °àH½'—Ì⎴ÿ@!Ìö&! V™„Ž ø !( ¼ªÿ@s&À!VCŒóÿ`Ìâ&¥ÿ!B‚„™GŒ„$$ ø $¼Óÿÿÿ$<œ'!à™Ðÿ½',¿¯(²¯$±¯ °¯¼¯ÂŒ!ˆ€™! ! @0@ÿÿ$ ø ¼!€@™…! ! ™¦'$*¥$EŽ!È@ ø °¯¼!(„™„$@!@£“¨“«“ª“¢“©“B§“¦“%Xc%HT L %Xj%I>6%0F ø %8g¼!,¿(²$± °!`à0½'‚DŒ ø !0¼òÿÿÿ$<œ'!à™Èÿ½'0¿¯,µ¯(´¯$³¯ ²¯±¯°¯¼¯!ÀHµ$!€ *Ò!˜€!ˆà¥$4@!eÿÿDCÆ$*Òùÿd¥$¢ŽN@„™!(  ø „$¼@!ˆ”!pE™¢0@0!0ÂÀ0!0‚(1& ø „&*2¼ñÿ`&™ ø  $$¼£®0¿,µ(´$³ ²±°à8½'¢Ž@!pF„Ã0@8!8ã™À8!( !8ã„$ ø ‚0¼ ®0¿,µ(´$³ ²±°à8½'„™ ø „$¼âÿ!p™ ø  $¼­ÿ<œ'!à™Àÿ½'8¿¯4³¯0²¯,±¯(°¯¼¯‘‡$!˜Àç$ ²'¬u9& ¢¯$ !€€‘‡ ²'¬u1&! $$ç$!È  ø ²¯¼! ‡ $ç$ `$ ¢™.@ $8¿4³0²,±(°à@½'!( ø ²¯¼¬u1&‡! $$ç$!È  ø ²¯¼! ‡ $ç$âÿ`$!È  ø ²¯¼ ¢'‡! ¢¯!È $$ ø ç$¼ ¢™Ôÿ@ $ ø ¼8¿4³0²,±(°à@½'<œ'!à™Àÿ½'8¿¯4³¯0²¯,±¯(°¯¼¯ƒ’b$eŒFŒQ& GC™%ª&ªEº&º '¢$!0  $#¢ ø !€€¼!˜@™!  $Œ$@¦' ø ¼@!˜@„£$™)b„$„$™e„$¢B,@!` ¢ E!`8¿4³0²,±(°à@½'%’¢0@0!0ÂÀ0!0 ø ‚(!`¼8¿4³0²,±(°à@½'E’¢0@0!0ÂÀ0!0 ø ‚(%’¼¢0@0„!0™À0!0‚( ø „$¼™ ø  $¼£ºÿ<œ'!à™Àÿ½'8¿¯4³¯0²¯,±¯(°¯¼¯Ñ$™!˜€! „…0Ž! '$™„$+¥$!È@ ø ! ¼™!@!  ø ¼¢¯$¢¯  ¯"Ž@! @™€ 9' ø ¼¢¯™ EŽ! `¦' ø  $¼8¿4³0²,±(°à@½'ãÿ ¯‚GŒ ø $¼ðÿÿÿ$<œ'!à™Øÿ½' ¿¯¼¯¢Œ™¦'$ÿÿ$@!(@ ø ¼!@„™@„$¥“¦“ ø ¼! ¿!`à(½'<œ'!à™ÿ„0gÿ„$)‚($@ÿÿ4€‚@  B$! ‚ƒ”B!be  ÿÿc0à!`€!E(„$íÿ@(€!E(„$÷ÿ€@(æÿ<œ'!à™ÿÿ…0¢,!@!]¢,@™$€!E@(]£,ûÿ`Øÿ%‚!0 I$ÿæ0'Â,@!È@!id”b”#DÂ!CC! ‚+ ¤ðÿ€Ç$!ÈÿC0à!`<œ'!à™¨ÿ½'T¿¯P¶¯Lµ¯H´¯D³¯@²¯<±¯8°¯¼¯‡Ñ$â$HãŒFŒ £¯$¦¯(¨£0Ž!°€!˜?! ¢Œ0@ÿÿ$™ ø  ¤'¼! À™G$$ ø  ¦'¼"@!@ °ÿ<ÿÿB4$€*“`! ™„|9' ø ÿ„0¼¤!0ƒ0€#@8¢¯‚!8ã„™B$À8!8㢯„$ ø !(¼!T¿P¶LµH´D³@²<±8°!`àX½'•™!  ø ¥&¼E@$…™¥$ ø ! ¼J@1&0Ž$™¥& ø ! ¼@0Ž$Øÿÿÿ$™ ø ! !€@ÿÿ$¼[$Íÿÿÿ$$YBB*A@$$WB™ ø  ¤' °'¼€!€<%˜b™s¬ ø ! ¼! À™!0G$ ø $¼¬ÿ@!@ªÿ!1&0Ž$¥ÿÿÿ$…™¥$ ø ! ¼¸ÿ@…™¥$ ø ! ¼@…™¥$ ø ! ¼«ÿ@1&0Ž§ÿ$mÿÿ$ÂÿBÿÿ4*P@!(ÿÿ4™}9' ø ÿÿ¤0¼¶ÿ!˜@1&0Ž“ÿ$$©ÿB$­ÿ!˜\ÿ&©ÿ€˜<œ'!à™xÿ½'€¿¯|±¯x°¯¼¯™¥Œ¦' ø ]$¼@!ˆ@0°“£“+p@™„|9' ø ! ¼2@8„!8ã™À8!8ã„$!(@ ø ‚0¼! €¿|±x°àˆ½'çÿ!€`<œ'!à™¸ÿ½'D¿¯@´¯<³¯8²¯4±¯0°¯¼¯Ò$PŽ!˜ &! €¥Œ7 ÿÿ$™$ ø  ¦'¼0@!8@ ¢—?@‚E$&¢—„$§—"¦—™¢¯ ø „$¼!8D¿@´<³8²4±0°!ààH½' ±Œ ÿÿ$…™¥$ ø ! ¼@$ ¢§™$! €!(  ø  ¦'¼!8@D¿@´<³8²4±0°!ààH½'…™¥$ ø ! ¼@$æÿ ¢§‚ÃÿE$™  §! (¥' ø !0"¢§(¢¼C€Þÿ`ÿÿ$R&DŽÙÿ€(¥'™ ø !0$¢§(¢¼C€Îÿ`ÿÿ$DŽÊÿ€(¥'™ ø !0&¢§(¢¼C€¿ÿ`ÿÿ$ qŽ´ÿ<œ'!à™Èÿ½'4¿¯0¶¯,µ¯(´¯$³¯ ²¯±¯°¯¼¯Ð$“Ž! !¨€t&4@T$¢Œ%@ÿÿ$v®™¥Œ!0€ ø  $¼@!@bŽ!€@‘&“@!™ ø ! ¼EŽ™!0@ ø d&ƒŽ&+¼T.îÿ`1&!4¿0¶,µ(´$³ ²±°!`à8½' ¢Œòÿ@ÿÿ$`®…Ž™¥$ ø ! ¼ @! …™ ø ¥$¼@!   EŽ™!  !0€$4¿0¶,µ(´$³ ²±° 8½'v®™EŽ!0€ ø  $¼Èÿ@!@gŽŽ@!G@!T€Q$Tâ,!à@@8™ ø !( ¼@‚Ž&C$ƒ®ŽTb,ðÿ€1&@8!8ã@8 EŽ™!  !0€Êÿç$ƒŽöÿ@8„™Ž ø „$¼™ÿÿÿ$<œ'!à™Ðÿ½',¿¯(´¯$³¯ ²¯±¯°¯¼¯‘™!  ÅŒ!€€ ø $&¼…Ž™! && ø  $¼@!@"Ž3&p&@!ˆ’™ ø ! ¼…Ž™!0@ ø D&cŽ1&+#¼ñÿ`&!,¿(´$³ ²±°!`à0½'<œ'!à™™£$!0 !8<œ'!à™Ðÿ½'(¿¯$±¯ °¯¼¯ÐŒ+!ˆ€…™¥$ ø ! ¼@ ¯™! Ž$¦' ø $¼!€@!(¿$± °à0½'…™¥$ ø ! ¼'@$…™¥$ ø ! ¼7@$àÿ¢¯™$¦' ø $!€@¼àÿ¥ $¢$¢„™ ø „$¼Îÿ!Ãÿ¢¯„™ ø „$¼Äÿ!„™ ø „$÷ÿ„™ ø „$ðÿ„™„$ ø !(¼®ÿÿÿ$<œ'!à™¸ÿ½'D¿¯@¶¯<µ¯8´¯4³¯0²¯,±¯(°¯¼¯™Œ$¦' ø  $¼$@!@£b,*@`$”•–$$°'Ž™R„&™S¤&Ä& ø 1&¢+Q¼ñÿ@&™ ø  $¼!D¿@¶<µ8´4³0²,±(°!`àH½'$Õÿ£¯<œ'!à™Xÿ½' ¿¯œ±¯˜°¯¼¯™´$¦' ø €$¼@!@¥“  °'‘™..& ø $&’¼÷ÿ ™ ø  $¼! ¿œ±˜°!`਽'<œ'!à™°ý½'H¿¯D·¯@¶¯<µ¯8´¯4³¯0²¯,±¯(°¯¼¯Õ$£Ž!¸€!° !ˆS`ÿÿ$…™! ` ø ¥$¼ˆ@!@„™¥Ž” ø „$¼„Ž™ ø !€³'¼ ¯ ÅŽ ø ¼!ˆ@™@.$ ø °¯¼„Ž™ ø ¼™! `$!8@ ø $¼!€™¦'G$âÿ@! à™ ø ! @¼ @$™ ø ! @¼¥Ž„™!ˆ@„$ ø ¼™ ø ! @¼! H¿D·@¶<µ8´4³0²,±(°àP½'„™ ¦¯ ø „$ ¦$¼Âÿÿ$À„™¥Ûÿ„$‚…DŒ™ ø ¥$Ôÿ$ $™! àÿ$ ¦' ø $!ˆ@¼õÿ@ÿÿ& ¦óÿÔ $Üÿ ¦Ùÿ‚…™DŒ¦Ž ø ¥$¼ºÿþÿ$<œ'!à™Hü½'°¿¯¬µ¯¨´¯¤³¯ ²¯œ±¯˜°¯¼¯Ò$CŽ!¨€!  I`ÿÿ$…™! ` ø ¥$¼“@!˜@™¤'$$ ø !8@¼! `™ ø !ˆ@¼;@!(@™ ø ! `¼L@SH<£FLB48b¦' ƒŽ$^b"2J@‚!€ÀF$„™GŽ!(  ø „$¼‚™DŒ ø ¼ …Ž™!0!   ø !8 ¼9@!€@™ ø ! `¼!°¿¬µ¨´¤³ ²œ±˜°à¸½'„™FŽ ø „$¼êÿýÿ$ ƒŽ$/b£ìÿq$"2@!&@ íÿq$‚,°'ÃÿF$„™EŽ ø „$¼Òÿüÿ$„™EŽ„$ ø !0 ¼Éÿùÿ$„™FŽ„$ ø !(@¼Àÿ„™EŽ ø „$¼¸ÿúÿ$„™EŽ ø „$¼‚™DŒ ø ûÿ$¼©ÿ‚…™DŒFŽ ø ¥$¼¥ÿþÿ$<œ'!à™Èÿ½'4¿¯0°¯¼¯ ¯ ¯  ¯$ ¯( ¯™¥Œ¦' ø $¼!€@„™@„$¥¦(§ ø ¼ ¥„™$¦ ø „$¼!4¿0°à8½'<œ'!à™Ðÿ½'(¿¯$±¯ °¯¼¯ÂŒ!€ @!ˆ€¥Œ ÿÿ$™¦' ø $¼ @!0@¢$D0*ƒ‚(?@$G‚$M‚!0(¿$± °!Àà0½'™! @!0 ¯ ø ¥'! @¢¼C€îÿ`ÿÿ$$‚‚(F@$‚$‚(¿$± °!Àà0½'„™ ø „$¼×ÿ!0¤¯ Ž™¦'!  ø $!0@¼(¿$± °!Àà0½'Åÿ€„™ ø „$¼¾ÿ!0„™ ø „$¼¶ÿ!0„™ ø „$£¼€c0 `„™ ø „$¼¤ÿ!0¾ÿ€ÿÿ$Ëÿ ¯„™ ø „$¼˜ÿ!0<œ'!à™Øÿ½' ¿¯±¯°¯¼¯‚€ @!ˆ€™ ø !@B,¼@!b,@! ø ¼Ž™!0@ ø ! ¼@!&Ž™ñÿ@! ! ¿±°à(½'<œ'!à™Èÿ½'0¿¯,µ¯(´¯$³¯ ²¯±¯°¯¼¯”Ò$€¢‚QŽ!˜ P$n !¨€…™¥$ ø ! ¼E@ $“&‚® `®R&BŽy@`®™!  †&$ ø  $!@¼G@!@„™ ø „$ cŽ¼`!ˆ‚•Ø“T$p&!È€ ø ! ¼!(!01&™¤&@&FŒ ø  cŽ¼+#ïÿ`!È€!@0¿,µ(´$³ ²±°!`à8½' ø ¼‚@&Ž™! öÿ@!(@!€ ™ ø ! B,¼<@„™„$ ø !(¼$0¿,µ(´$³ ²±°!`à8½'™¥Œ†& ø  $¼ïÿ@!@‚‚[@„™ ø „$¼!0¿,µ(´$³ ²±°!`à8½'$q®…PŽ™¥$ ø ! ¼"@}ÿq®„™„$ ø !(¼!(™ ø „&¼™ ø „&¼ eŽ™!  †& ø G$¼²ÿA!„™ªÿ„$…™¥$ ø ! ¼(@$…™¥$ ø ! ¼ @$„™„$ ø !(¼–ÿÿÿ$„ÿŽ‚ÿ™Ø“9' ø „&¼@PŒ„™„$…& ø !0¼œÿ!-ÿb®<œ'!à™¸ÿ½'@¿¯<³¯8²¯4±¯0°¯¼¯Ð$( ¯Ž‚!˜€™! `R$`ÿÿ$ ø ÿQ0".¼@ÿÿ$ ±£Ž™! `!(@ ¦'`$ ø ! `¼! `™!(@ ¦'$øn9' ø !¢£¼!€@!0@¿<³8²4±0°!ÀàH½'™(¢'Ì#9' ø ¢¯¼Â‡„™„$!( ìÿ!0(¢F ø ¼äÿ!0<œ'!à™Ðÿ½'(¿¯$±¯ °¯¼¯Ð$Ž!ˆ€™! @$@ÿÿ$ ø &ÿC0b,¼@ÿÿ$££™„Ž!0 „$™@¥'!ÈÀ ø ! @¼¦'„…™„$¥$@$™øn9' ø ! ¼!(@(¿$± °! à0½' ø ¼öÿÿÿ$Ž ø ¼ðÿÿÿ$<œ'!à™Ðÿ½'(¿¯$±¯ °¯¼¯Ð$Ž!ˆ€™! @$@ÿÿ$ ø &ÿC0b,¼@ÿÿ$££™„Ž!0 „$™@¥'!ÈÀ ø ! @¼¦'„…™„$¥$@$™øn9' ø ! ¼!(@(¿$± °! à0½' ø ¼öÿÿÿ$Ž ø ¼ðÿÿÿ$<œ'!à™Èÿ½'4¿¯0²¯,±¯(°¯¼¯Ñ$0Ž!€(ÿÿ$„™  ¯„$ ø !(¼ @$„™„$ ø !(¼-@$¢£1&$Ž€™ ø ¥'¼@¦'…™! @¥$øn9' ø  $¼4¿0²,±(°à8½'„™ ø „$¼óÿÿÿ$„™%Ž ø „$¼ëÿÿÿ$„™ ø „$ïÿ<œ'!à™Èÿ½'4¿¯0²¯,±¯(°¯¼¯Ñ$0Ž!€'ÿÿ$„™  ¯„$ ø !(¼ @$„™„$ ø !(¼@$¢£1&$Ž €™ ø ¥'¼!@¦'…™! @¥$øn9' ø  $¼4¿0²,±(°à8½'„™„$ ø !(¼@Üÿ$„™ ø „$¼éÿÿÿ$„™%Ž ø „$¼áÿÿÿ$„™ ø „$ïÿ<œ'!à™ˆÿ½'t¿¯p²¯l±¯h°¯ ¼¯Ð$Ž!ˆ °@!€™ ø ! @(¢¯&Ž ¼ €ÿÿ$™ ø &,¢¯Ž ¼—€ÿÿ$™ ø &0¢¯Ž ¼Ž€ÿÿ$™ ø &4¢¯Ž ¼…€ÿÿ$™d¥' ø !08¢§d¢ ¼C€z`ÿÿ$&Žu€d¥'™ ø !0:¢§d¢ ¼C€j`ÿÿ$&Že€d¥'™ ø !0<¢§d¢ ¼C€Z`ÿÿ$&ŽU€d¥'™ ø !0>¢§d¢ ¼C€J`ÿÿ$&ŽE€™ ø &@¢¯Ž ¼<€ÿÿ$™ ø &D¢¯Ž ¼3€ÿÿ$™ ø &H¢¯Ž ¼*€ÿÿ$™ ø &L¢¯Ž ¼!€ÿÿ$™ ø &P¢¯Ž ¼€ÿÿ$™ ø T¢¯Ž ¼€ÿÿ$™ ø  ¼%Ž™! @(¦'4$øn9' ø X¢¯ ¼t¿p²l±h°àx½'™¥Œ`¢'!0!8¢¯Ì#9' ø ` ¯!ˆ@ ¼îÿ `°„ ŽŽŽŽ£¯–™¢¯–„$ ø £¯Ž ¼––Ž£¯ Ž„™¢¯ ø „$ ¼0Ž„$Ž(Ž,Ž™£¯ ø „$!  ¼t¿p²l±h°àx½'<œ'!à™¨ÿ½'P¿¯L±¯H°¯¼¯ƒ™pb$pfŒGŒKŒCŒ HŒIŒJŒ ¦¯$§¯(£¯,¨¯0©¯4ª¯8«¯¥Œ@¢'!8!0Ì#9' ø ¢¯!ˆ@¼ @°„Ž™€!(@B,„$@!£ eŒŽ ø ¼–™„ÿf0ÿÿc0! „$™ `!(`!È@ ø ¼! P¿L±H°àX½'„ ø „$õÿ„ ø „$¼ñÿÿÿ$<œ'!à™Ðÿ½',¿¯(²¯$±¯ °¯¼¯™±'!0 $! ö$ ø !€€¼! ™!0 !@ ™ @$EŽ!È ø ¼„™@„$‚£`E$„™ ø „$¼!,¿(²$± °à0½'‚ñÿE$„„$ ø ¼ðÿÿÿ$<œ'!à™Èþ½'0¿¯,³¯(²¯$±¯ °¯¼¯ƒ™b$gŒ IHŒCŒ §¯$¨¯(£¯,©£! !€Àö$-¦'$ ø !ˆ€¼O@ ³'Ž1! ™ ø ! ÿC0¼`3¢£b(@ÿ$b„™ÿ$¢¯„$!(!0 ø $¼!0¿,³(²$± °à8½'™ EŽ! !0` ø $¼ðÿA„™ ø „$¼éÿ!™EŽ!0` ø $¼@ ¢ƒ @‚E$„™ ø „$¼Òÿ!‚öÿE$„™ ø „$¼Çÿÿÿ$„™ ø „$¼¿ÿÿÿ$<œ'!à™Èÿ½'4¿¯0´¯,³¯(²¯$±¯ °¯¼¯Ð$Ž! €` !˜ …™¥$ ø ! ¼(@$&ŽC€™ ø ¥'¼D@ $‚ƒF$Ò¨¥R¸”d$…¨”e¸¢“™‚ £“ƒ  eŽ ø ! €¼4¿0´,³(²$± °à8½'…™¥$ ø ! ¼Òÿ@$…™¥$ ø ! ¼Êÿ@$…™¥$ ø ! ¼Âÿ@$„™„$ ø !( ¼Ùÿÿÿ$„™ ø „$¼Ñÿÿÿ$„Ž™ ø „$îÿ„™ ø „$ïÿ<œ'!à™Ðÿ½',¿¯(²¯$±¯ °¯¼¯Ð$™Ž!8 !€™&!ˆ ,@! @!Èà ø ¼¢£™„Ž!( ™#@„$!È  ø ! @¼¢§™„Ž!( ™@„$!È  ø ! @¼ %Ž™¢§ £! @¦' ø $¼,¿(²$± °à0½'„„$ ø ¼óÿÿÿ$<œ'!à™Ðÿ½',¿¯(²¯$±¯ °¯¼¯Ð$™Ž!8 !ˆ€™&! 2@! @!Èà ø +¼¢£™„Ž!( „$™'@&!È  ø ! @¼¢£™„Ž!( ™@„$!È  ø ! @¼¦'„™„$$@¢§™EŽøn9' ø ! ¼,¿(²$± °à0½'„„$ ø ¼ÿÿ$,¿(²$± °à0½'Ž ø ¼õÿÿÿ$<œ'!à™Øÿ½'$¿¯ ²¯±¯°¯¼¯ÅŒ1 !€ÆŒ À‘™ ø $&¼$’ 0&™ ø &¢&¼’öÿ€&™! @&&$¿ ²±°$ $ (½'„™„$ ø !(À¼$¿ ²±°ÿÿ$à(½'„™ ø „$òÿ<œ'!à™àÿ½'¿¯¼¯™ðª9' ø ¼!@„™@„$¿!`à ½' ø ¼!¿!`à ½'<œ'!à™ ¢Œ!0@!8™¥Œøn9' àÿÿ$<œ'!à™Èÿ½'0¿¯,µ¯(´¯$³¯ ²¯±¯°¯¼¯™!€À!  !ˆà ø !˜€C$H¢!p+R¼Lµ @òÿ$¢®!0¿,µ(´$³ ²±°!`à8½'! #™!(` ø ! ¼!€ ™ ø ¼¢&‚öÿ€!@ ®0¿,µ(´$³ ²±°!`à8½'™!(€ ø !0¼Ýÿ<œ'!à™Èÿ½'4¿¯0²¯,±¯(°¯¼¯H°L±™ ¢'!€¬¬9'!  ¢¯!(À±¯!0à ø !8¼ ¢™! @!0!8 $@!@4¿0²,±(°!`à8½' ø !@¼4¿0²,±(°!`à8½'<œ'!à™Èþ½'4¿¯0´¯,³¯(²¯$±¯ °¯¼¯!ˆà"*! À™ ³'!8$!€€@! ™!0´¯Ü­9' ø ±¯¼!€@!4¿0´,³(²$± °à8½'! ` ø !(¼$™! !(@!0Ü­9'!8¢¯ ø ³¯¼!€@™! €!(`ãÿ@!0  ø !¼4¿0´,³(²$± °à8½'<œ'!à™™ ®9' $<œ'!à™hþ½'”¿¯¶¯Œµ¯ˆ´¯„³¯€²¯|±¯x°¯¼¯™0²'!€À!˜€!ˆ ! @!( ø È$Ž¼`†™%ŽÆ$! ` ø $¼@! `‚…¼¯P$¥$!È ø h¦'¼@!ˆ@! ”¿¶Œµˆ´„³€²|±x°à˜½'™%Ž!0@ ø È$!˜@¼îÿ`0£4°—b0ã@r0‚E$b0ã@‚F$„™ ø „$¼4¤—™ ø  ¥'¼!(@„™ ø „$¼6¤—™ ø  ¥'¼!(@„™ ø „$8¥“¼¢0@0„!0™À0!0„$ ø ‚(9¥“¼¢0@0„!0™À0!0„$ ø ‚(B¥“¼¢0@0„!0™À0„$!0 ø ‚(:¤ƒ¼î€!€ƒ€#ƒ@ ! ƒ;¨ƒÀ .!0ƒ.Þ!8ƒ8€#@!C„À™!C„$ ø ¢¯¼ð2„™ ø „$¼ :‚.|wQ$!(!0@!È  ø o¤'¼™ ø  $¼„™ ø „$!(!0@!È  ø œ¤'¼™ ø  $¼„™ ø „$!(ɤ'!È  ø !0@¼™ ø  $¼u@„™ ø „$<£“¼`!€‘ µ'!°E™¢0@0!0ÂÀ0!0‚( ø $&<£“&*¼ñÿ`!°™ ø  $¼_@ $!`”¿¶Œµˆ´„³€²|±x°à˜½'‚…™DŒ&Ž ø ¥$¼òþ‚E$b0ÿ@‚ÿF$…! `¥$!È ø l¦'¼ôþ@!ˆ@l´—™ø°'! € ø !(¼! `™$¦' ø ]$¼äþ@!ˆ@™!( ø ! €¼!(@„™ ø „$¥“¼¢0@0„!0™À0!0„$ ø ‚( ¥“¼¢0@0„!0™À0!0„$ ø ‚(!¥“¼¢0@0„!0™À0!0„$ ø ‚(h£¼c0`‚E$„™ ø „$¼„™ ø „$¼$™p¢¯! `¦$p¦' ø $¼@!ˆ@p¢€B0ë@‚D$™ ø ¼"¥“„¢0@0!0™À0„$!0 ø ‚(b¤ƒ¼d€!€ƒ€#ƒ@ ! ƒc¨ƒÀ .!0ƒ.T!8ƒ8€#@!C„À™!C„$ ø ¢¯¼!€„™ ø „$¼ µ'“™’ ø d&¼!°ôE™¢0@0!0ÂÀ0!0‚(& ø D&*¼òÿ`!°–™ ø Ä&¼$!°ôE™¢0@0!0ÂÀ0!0‚(& ø D& *¼òÿ`!°„™ ø „$ðƒ2 $¼{b<¥“„¢0@0!0™À0!0‚( ø „$¼$„™ ø „$¼“™ ø d&¼!°6E™¢0@0!0ÂÀ0!0‚(& ø D& *¼òÿ`!°™ ø  $¼$„™ ø „$¼™ ø d&¼!°E™¢0@0!0ÂÀ0!0‚(& ø D& *¼ñÿ`™ ø  $¼Ëý! =¥“„¢0@0!0™À0!0„$ ø ‚(¼ $¡þ‚A¥“„¢0@0!0™À0!0„$ ø ‚(¼”þ!`"þ%þ‚$‚úþE$‚ÿD$;¥“„¢0@0!0™À0!0„$ ø ‚(d¥“¼¢0@0„!0™À0!0‚( ø „$¼ $™ ø !€¼„™ ø „$¼™ ø d&¼!°)E™¢0@0!0ÂÀ0!0‚(& ø D&*¼òÿ`!°™ ø Ä&¼$!°)E™¢0@0!0ÂÀ0!0‚(& ø D& *¼òÿ`!°™ ø  $¼!€„™ ø „$¼™ ø d&¼!°E™¢0@0!0ÂÀ0!0‚(& ø D&*¼òÿ`!°™ ø Ä&¼$!°E™¢0@0!0ÂÀ0!0‚(& ø D& *¼ñÿ`Hÿ¬þ%œþ‚$<œ'!à™ÿ½'迯䷯දܵ¯Ø´¯Ô³¯Ð²¯Ì±¯È°¯¼¯™!¸ …À¦'¥$À ¯¼¯9' ø !°€¼ @$ÿÿ$ÿÿ$!˜™åŽ! À³¯¦' ø ¤$!€@µ£“´¢“¶¤“%C·£“%D¸¤“%C¹£“%D%CÿB0¼@!ˆˆ¢@ÿÿ$$ÿÿ$‚ ·•!(€„™„$ ø !0 ¼ÿÿ$ÿÿ$Äb.h@‚B$„™§„$!0@ ø !(`ˆ£¼b,@€ƒØc$!CDŒ! œ€„™ ø „$¼À¢@Œ¢B0ª@™ ø  $¥¼t Œ¢B0~@„™ ø „$¥¼ !€‘²'!E™ ø $&¥&+¼öÿ@! !€‚²'DŒ!C@!db”@B0@&+ôÿ@!‚°™ ø  $¼iÿs&R ÿÿ$‚!¨`aÿs&! `üÿ!¨`„™ ø „$¼¥ÿ„™ ø „$¼ÿ„™ ø „$¼•ÿ„™ ø „$¼ÿ„™ ø „$¼…ÿ„™ ø „$¼}ÿ„™ ø „$¼·ÿ„™„$ ø !( Iÿ„™ ø „$¼¥{ÿ™ ø ´¤'¼Cÿ@!!è¿ä·à¶ÜµØ´Ô³Ð²Ì±È°!`àð½'™ ø *$¼Qÿ‚„™GŒ„$ ø $¼íþÿÿ$„™„$ ø  ¦'¼xÿ<œ'!à™Ðÿ½'(¿¯$³¯ ²¯±¯°¯¼¯‚™Q$!€€!(!  ø  $¼! …™¥$!0  ®9' ø $¼#@!˜@„™’ ø „$¼!€€.@Â!QF20fÆ0!(™&óÿÀD& ø €.¼ñÿ@„™ ø „$¼!`(¿$³ ²±°à0½'<œ'!à™Èÿ½'4¿¯0²¯,±¯(°¯¼¯…™$ $¥$$£¯–$¢¯!ˆ€ ø ,&¼™ ø ,&¼™ ø $¼!€@™! ! !(™D$!È@’ ø ¼! …™¥$!0 ®9' ø $¼!0@™…„! ¥$™@„$ ø !(¼™ ø ! ¼!4¿0²,±(°à8½'DŽ!È` ø ¼! …™¥$¼¯9' ø  ¦'¼DŽ…™ ¦ ø ¥$¼™ ø ! ¼ßÿþÿ$‚…DŒ ø ¥$¼×ÿÿÿ$<œ'!à™`ÿ½'˜¿¯¼¯…™¥$€$ ®9' ø ¦'¼§'…™ @¥$‚ƒDŒfŒ ø ¼˜¿à ½'‚ƒ…DŒfŒ ø ¥$¼˜¿à ½'<œ'!à™Èÿ½'4¿¯0²¯,±¯(°¯¼¯!€ÑŒ„™Ð$< „$Ž™ ¥'!0@! @$ ¯™& $! @Ü­9'!( $¦'$¢¯ ø °¯¼! ™@!@4¿0²,±(°!`à8½' ø $¢¯¼ ¢„C€™„$Þÿ`!0 Ž ø ¼éÿÿÿ$ ø ¼!4¿0²,±(°!`à8½' ø ¼Ùÿÿÿ$<œ'!à™ ÿ½'Ø¿¯Ô·¯Ð¶¯Ìµ¯È´¯Ä³¯À²¯¼±¯¸°¯¼¯™@$™EŽ\Í9' ø ¼!€@„™„$8!,¿(²$± °à0½'™EŽ ®9' ø ¼!€@™! ™@¤'!È` ø ¼%Ž„™„$ ø !0@¼,¿(²$± °!à0½'„%Ž ø „$¼!,¿(²$± °à0½'„ ø „$¼Êÿÿÿ$%Ž ø ¼ïÿ!<œ'!à™Ðÿ½',¿¯(²¯$±¯ °¯¼¯Ð$Ž!€  ! !c$bŒüÿ@„$€‚,…™! @¥$& ®9' ø  $¼ @ÿÿ$‚ƒ„™Ž”FŒ˜gŒ ø „$¼! ,¿(²$± °!€à0½'øÿ@ÿÿ$™!  !0 ø ¥'!ˆ@¢¼C€ìÿ`ÿÿ$Ž™¥' ø !0!@@¢¼C€àÿ`ÿÿ$'$HÜÿ@‚…™F$! @Ȭ¥$Q¬\Í9' ø $! @¼,¿(²$± °!€à0½'<œ'!à™Èÿ½'4¿¯0´¯,³¯(²¯$±¯ °¯¼¯ÐŒ!˜ …™¥$!€!  ø !ˆÀ¼$…™¥$ @!  ø $¼!(„™0@„$™ ø È$¼!€@™! ! !(™AÈ$!È@ ø ¼È$™!0 !(`! @&A9' ø ¢¯¼!ˆ@…! @¥$@!0™ ø ! ¼! 4¿0´,³(²$± °à8½' ø ¼4¿0´,³(²$± °!à8½'$DŽ®‚™B$ $@8¦,ç$¢¯£¯¤Ì9' ø ¦¼Õÿ!ˆ@‚…DŒ ø ¥$¼Óÿÿÿ$<œ'!à™Àÿ½'<¿¯8¾¯4·¯0¶¯,µ¯(´¯$³¯ ²¯±¯°¯¼¯‚™T$!°€! €!˜à!¸  ø !ðÀ¼! À™ ø !€@Q$!!ST£R$¼!@P§Xµ`+r!0™!(€! à@!€ðòÿ$¢®<¿8¾4·0¶,µ(´$³ ²±°!à@½' ø ¼! ™!€!(À ø !0 ª¼º&™!(À!0``!  ®!@@<¿8¾4·0¶,µ(´$³ ²±°!à@½' ø ¼!@@îÿ ®<œ'!à™Àÿ½'8¿¯4±¯0°¯ ¼¯T°™X¢(£'!ˆ€!  !(À!0àP§£¯ì9'¢¯ ø °¯!8@ ¼(¢™! !0$@!@8¿4±0°!`à@½' ø !@ ¼8¿4±0°!`à@½'<œ'!à™Àþ½'<¿¯8´¯4³¯0²¯,±¯(°¯ ¼¯™(´'!ˆ€! !˜À! €!($ ø !€à ¼P¢™¢¯$´¯! !(@!0`!8œí9' ø ¢¯ ¼<¿8´4³0²,±(°à@½'<œ'!à™Øÿ½' ¿¯¼¯™$4§¯¢¯Xî9' ø 4§'¼ ¿à(½'<œ'!à™ÿ½'迯䳯ಯܱ¯Ø°¯ ¼¯™(±'!€À!€¤$! !˜ Ð ¯ ø !( ¼&…™¥$Ц'Ô§' 79' ø !  ¼)@!(@Ô¢™€!€Žÿÿ$& `! ` ø  ¼Ž™! !( $.`(¢¯™ˆj9' ø  ¼@ÿÿ$…Ô¢™! @!0 ¤$@¥$ eŽ ø  ¼!(@è¿ä³à²Ü±Ø°! àð½'‚™¤$£¯B$ $Ц! @!8 ¢¯œí9' ø £¯ ¼éÿ!(@‚„GŒ$ ø „$ ¼àÿÿÿ$<œ'!à™Àÿ½'<¿¯8²¯4±¯0°¯ ¼¯T°X±™!€(¢'!  !(À!0àP§ì9'¢¯°¯ ø ±¯ ¼(¢™! @!0!8 $@!@<¿8²4±0°!`à@½' ø !@ ¼<¿8²4±0°!`à@½'<œ'!à™¸þ½'@¿¯<µ¯8´¯4³¯0²¯,±¯(°¯ ¼¯X±!¨à"*™(²'!8!€€!˜ @! À™µ¯±¯ôð9' ø  ¯ ¼!€@!@¿<µ8´4³0²,±(°àH½'! @!( ø $ ¼$™! !(`!0€ôð9'!8¢¯ ¯ ø ²¯ ¼!€@™!  !(@àÿ@!0  ø ! ¼@¿<µ8´4³0²,±(°àH½'<œ'!à™ÿ½'迯䳯ಯܱ¯Ø°¯¼¯’™Ñ$!˜€E&! Ц'Ô§' 79' ø Р¯!€@¼2Ô£€!ˆ"1Ž1 ™ ø ! !@!B,¼V@¬°'™f$¨£¯!(  ø ! ¼¨¦™!( ø  ¤'¼ ¥'„™ ø „$Ô¢¼4@¨§'™!0à! `$ ø $$¼!€@!è¿ä³à²Ü±Ø°àð½'`! `™$$ЦE&¨§'¼ñ9' ø ¢¯!€@¼ìÿ ¤'™¨¦ ø ¬¥'¼ ¥'„™ ø „$¼Þÿ!™$¨¦' ø $$éÿ!€@™$$Ц! `E&Xî9' ø ¢¯¼Ëÿ!€@‚…™DŒ¥$ ø !0 ¼Âÿÿÿ$<œ'!à™Øÿ½' ¿¯¼¯™$¼ñ9' ø ¢¯¼ ¿à(½'<œ'!à™¨ÿ½'T¿¯P¾¯L·¯H¶¯Dµ¯@´¯<³¯8²¯4±¯0°¯¼¯™ ¯Ó$¥Œ¦'X¤¯§' 79' ø ! `¼D@!¨@£€!˜beŽI œ`…™¦X¤¥$õ9' ø  §'¼/@!¨@„™ ¥ ø „$ ¤¼Ì€!À &!bbŒR&$D„™@„$B*@À &!b ¤bŒR&$D„™ôÿ@„$eŒ ø B*¼ðÿ@À™ ø  $¼! T¿P¾L·H¶Dµ@´<³8²4±0°àX½'‚£€DŒ@!db”B0U@$  ¯ &!ð!0! `$bŒÿÿR&%0ÂüÿAc$cŽ'`ÿÿF0”&‚Žüÿ@Þ'! `*À!¸€!˜T‚pŽB$QŒ!°!$Ž™(¦¯ ø !(R&¼(¦ @D*"Ž £s&%C ¢¯pŽ$!¨ìÿ€1&bÀ ¢$Â]@÷&*þÛÿ@€* ‚…™DŒfŽ ø ¥$¼ ÿ! …™X¤¥$¼¯9' ø  ¦'eÿ™!  !( ø !0¼ ¢¯ &!$‚ŒÿÿR&%büÿA„$' ¢ÿÿc0$b/@$¢@…™ ¦X¤Î9' ø ¥$¼!¨@! T¿P¾L·H¶Dµ@´<³8²4±0°àX½'…™¦ §X¤ï9' ø ¥$¼éÿ!¨@„™ ø „$¼ ¤-ÿ‘„™'Ž„$$ ø $¼'Ž„™„$$ ø 9$¼$‚“ P$™ŽŽ$Že& ø ÿÿR&¼÷ÿA&™ ø  $,ÿ<œ'!à™Àÿ½'<¿¯8´¯4³¯0²¯,±¯(°¯¼¯“™Ñ$! €e&! ¦'§' 79' ø  ¯!€@¼²€!ˆ"0Ž'@! €™¦e&õ9' ø  §'¼%@!€@!<¿8´4³0²,±(°à@½'…™¥$ ø ! ¼@!   ¯&@! €™†$ ¦' ø $¼!€@åÿ!™…$ ¦' ø $Úÿ™ ¤ ø ¼×ÿ!™$¥' ø !0 ¢¯$¢¼C€Ìÿ`ÿÿ$²Úÿ™¦ §ï9' ø e&¼Úÿ!€@<œ'!à™¸ÿ½'@¿¯<µ¯8´¯4³¯0²¯,±¯(°¯¼¯ÔŒ™Ñ$!¨€!˜ ! !(€¦'§' 79' ø  ¯¼@! @²@€ cŽ$b!  ™!(` ø üÿ&&¼! @@¿<µ8´4³0²,±(°!€àH½'€!ˆ"0Ž ÿÿ$cŽíÿbÿÿ$3@!(€™!  ¼¯9' ø  ¦'¼!€@âÿ@! @™ ¤ ø ¼! @¿<µ8´4³0²,±(°!€àH½' cŽÎÿbÿÿ$…™¥$ ø ! ¼@$ ¢¯@™ ¦!  Î9' ø !(€¼!€@Þÿ! ™¦!  õ9' ø  §'Ìÿ…™¥$ ø ! ¼ @$¥'ãÿ  ¯™¦ §!  ï9' ø !(€¼ãÿ!€@™!  ø !0 ¢¯$¢¼C€’ÿ`ÿÿ$²Ëÿ<œ'!à™¸ÿ½'@¿¯<³¯8²¯4±¯0°¯¼¯’™Ñ$!˜€E&! (¦',§' 79' ø ( ¯¼#@!@,£€!ˆ"$Ž*€!`! `™$(¦E& §'¼ñ9' ø ¢¯¼!€@ @!@™ ø  ¤'¼™ ø ! @¼!@¿<³8²4±0°!`àH½'™$ ¦' ø $âÿ™ ø  ¥'¼ëÿ@ÿÿ$,¢ @$™! `$ ¦' ø $¼!€@Ýÿ!™(¦! `E& §'Xî9' ø ¢¯¼ôÿ!€@<œ'!à™Èÿ½'4¿¯0²¯,±¯(°¯¼¯  ¯ÅŒH !€€…™ ¢'¥$!0!8Ì#9' ø ¢¯¼.@!ˆ@ °‚@! 4¿0²,±(°à8½'™ ø ! ¼™ ø ! !PC€¼ëÿ`P$™ ø ! ¼™ ø ! !PC€¼ãÿ`P$Ûÿ! ’™!  $F& ø  $!ˆ@¼Ðÿ B&Æÿ ¢¯„™ ø „$¼Åÿÿÿ$<œ'!à™Àÿ½'8¿¯4³¯0²¯,±¯(°¯¼¯Æ$!˜€ÑŒ„™? „$™ÂŒ!8 ! ™’1@!(@!Èà ø ¼G$…™ ¢'¥$Ì#9'!0 ! ` ø ¢¯¼!€@™@!( ™ ø D&¼!8¿4³0²,±(°à@½'’ ø D&¼! `™$F& ø  $!€@¼ìÿäÿ„ ø „$¼äÿÿÿ$ ø ¼ßÿÿÿ$<œ'!à™Øÿ½'$¿¯ ²¯±¯°¯¼¯ÑŒ!€„™„$!(  ø !€À¼„™@„$&Ž+ ™Ž…!8 ¥$™!0@,@! !Èà ø =$¼!( ™&!8 ™'@!0!Èà ø ¼™ ø &¼! @™&$¿ ²±°G$ $ (½' ø ¼$¿ ²±°ÿÿ$à(½'‚DŒ ø òÿ‚…DŒ ø ¥$ëÿ<œ'!à™¸ÿ½'D¿¯@¾¯<·¯8¶¯4µ¯0´¯,³¯(²¯$±¯ °¯¼¯ÂŒH¤¯`@L¥¯$!˜ÿ$¢¯*óM@!‚”^ŒU$/‘& 6£Ž¢Ž ¤’ ¥’™ #ª>ª"ª#º $¢ %¢! "º ø žºB$!QP¨P¸¼L¢™EŒH¤!0  ø  $¼(@‚RŒC2`¶¢;@s&*ó@!ÿp2.Ïÿ@Îÿ6B26@¢ðÿ@„™ ø „$¼s&*óëÿ@ÿp2!D¿@¾<·8¶4µ0´,³(²$± °àH½'™ ø ! @!˜@¼!¸@ÿ@ ¯L¢„™EŒ ø „$¼ãÿÿÿ$„™ ø „$¼×ÿs&„™„$ ø ÿ2C2¼`„™ ø „$B2¼@@B2@ B2%@B2,@™ $ ø s&¼¹ÿ*ó„™ ø „$B2¼ëÿ@@B2„™ ø „$@B2¼äÿ@ B2„™ ø „$ B2¼Ýÿ@B2„™ ø „$B2¼Öÿ@„™„$ ø !(À¼™Îÿ $<œ'!à™Àÿ½'8¿¯4³¯0²¯,±¯(°¯¼¯Ð$Ž!ˆ€! ™!0! @ ¥'@ÿÿ$“ ø $¢¯ ¢¼C€! ™$¦'$"`h&™EŽ $Ü­9'¨¯ ø ¢¯¼™ @!@8¿4³0²,±(°!`à@½'dŽ ø $¤¯¼!8¿4³0²,±(°!`à@½'„Ž ø „$¼åÿÿÿ$<œ'!à™Àÿ½'8¿¯4³¯0²¯,±¯(°¯¼¯Ð$Ž!ˆ€! ™!0! @ ¥'@ÿÿ$“ ø $¢¯ ¢¼C€! ™$¦'$"`h&™EŽ $Ü­9'¨¯ ø ¢¯¼™ @!@8¿4³0²,±(°!`à@½'dŽ ø $¤¯¼!8¿4³0²,±(°!`à@½'„Ž ø „$¼åÿÿÿ$<œ'!à™¨ÿ½'P¿¯L³¯H²¯D±¯@°¯0¼¯Ñ$"Ž!˜€@! ™! @ ø 8¥'0¼@„™ ø „$0¼ÿÿ$P¿L³H²D±@°!`àX½'ƒ‚d$eŒ†ŒP$ƒ™ªªE¸º¢ ø ! B$8¤!PD¨D¸=£“0¼C <¤“™D EŽ! `!0 ø  $0¼×ÿ@!@„™%Ž ø „$0¼„™ ø „$0¼Ž™ ø &0¼ Ž„™ ø „$0¼Ž„™ ø „$Ž0¼c0W`‚C$Ž¢0p@‚F$ ¢0g@‚G$„™!(` ø „$Ž0¼¢0W@‚F$¢0N@‚G$¢0E@‚C$¢0<@£¯‚C$¢03@£¯‚C$¢0*@£¯‚C$¢0!@£¯‚C$¢0@ £¯‚C$ ¢0@$£¯‚B$„™(¢¯ ø „$0¼\ÿ!‚«ÿC$‚óÿB$‚êÿC$‚áÿC$‚ØÿC$‚ÏÿC$‚ÆÿC$‚½ÿC$‚´ÿG$‚«ÿF$‚›ÿG$‚’ÿF$<œ'!à™¨ÿ½'P¿¯¼¯™ ¦'0$ ø b$¼!@„™@„$P¿!`àX½' ¥ ø ¼$¥„™ ø „$¼(¥„™ ø „$¼L¥„™ ø „$¼,¥„™ ø „$¼0¥„™ ø „$¼4¥„™ ø „$¼8¥„™ ø „$¼<¤—™ ø ¥'¼!(@„™ ø „$¼@¥„™ ø „$¼D¥„™ ø „$¼H¥„™ ø „$¼!P¿!`àX½'<œ'!à™èþ½'¿¯¾¯ ·¯¶¯µ¯´¯ü³¯ø²¯ô±¯ð°¯¼¯•™°&!ˆÀ¤¯!( $ ø ! ¼° ¯ƒ™dŒb$FCEª¤º¢¢¢! ´ ¯¸ ¯¼ ¯Ø ¯Ü ¯à ¯ä ¯ ø è ¯¼R$ƒ† c$™eŒÆ$¤'!ðP ø R$¼1&–—!˜$™¤' ø !( !@ÿÿ$¼Tb©tt$'¥“ ¢&€&kƒ!ˆ"c$sbd$€bp$‡b%¢“ßÿ@¨°™!  ø Å&¼@$™!  ø å&¼ @$‚™!  ø E$¼Á@$`¢&Ø£!BC¨Ü¥C¸E¨à£E¸ C¨ä¤C¸D¨è¦ D¸F¨´£¥$c$F¸R&´£¯Ü¥¯Ù £™Ø§£¤' ø !( !@ÿÿ$¼®ÿb$c`¢&´¤H€¦&¼¢™ ¯°£į︢¯¤!8@ ø $¼¿¾ ·¶µ´ü³ø²ô±ð°à½'&¢“V@%`¬¢°¢¯c$ÿb&¢“a@¬¢ÿC0 c4B(@ d4d4d$‚ÿbÚ¤§&¢“F@¬¢è¢¯p${ÿbyÿÙ´£¬¢jÿÜ¢¯‚…DŒ‚™ B$FŒ ø ¥$¼¿¾ ·¶µ´ü³ø²ô±ð°ÿÿ$à½'ؤ!BD¨Ü£D¸C¨à¤C¸ D¨ä£D¸C¨è¤ C¸D¨´£R&c$D¸Šÿ´£¯ƒ‚… c$DŒ™¨§fŒ¥$ ø ¼Ñÿƒ‚… c$DŒ™¨§fŒòÿ¥$‚…DŒ‚™ B$¨§FŒ ø ¥$èÿƒ‚… c$DŒ™fŒ¥$ ø !8Üÿ<œ'!à™ÿ½'ô¿¯ð¾¯ì·¯è¶¯äµ¯à´¯Ü³¯Ø²¯Ô±¯Ð°¯¼¯ƒ‘eŒb$0&GFCª™%º¢¢¢$!0 ø  $¼@È¢¯È¢ô¿ð¾ì·è¶äµà´Ü³Ø²Ô±Ð°àø½'„%Ž™Ž ø „$Ž¼êÿ &‚8´'WŒ‚^$"*áÿ@ŠŠš ŠŠŠŠ¢¯šš ššš¨ƒ$§¯ £¯$¤¯(¥¯,¦¯&Ýèÿ1&$å$Û‚E$„™„$ ø ¥“¼¢0 @!0€ƒ@¦'bŒd$‚ªƒŒ‚ºƒªƒº‚¥“@¢£¢0@¢0†ר׸Æ$™"$'ƒ¨¸à¥“Æ$¢0@¢0†ר׸Æ$™Ã"Ä“¨¸ “èøÄ   ¥“ Æ$¢0@†ר׸Æ$ƒbŒd$¨ƒŒÂ¸èø¥“Æ$†„.™„$. ø !0€¼¥„™ ø „$£“¼c0`,¦#ˆ&uÿ !€È¢ô¿ð¾ì·è¶äµà´Ü³Ø²Ô±Ð°àø½'£—ðb0B8`@ÿe0‚F$„™ ø „$¼$¦„™ ¥ ø „$¼(¥„™ ø „$,¦¼*&k@$£ƒGb$Yb$ÈÿbÂ,Æÿ@€ÿ$ŠŠ ŠŠššš š¦'!¨ Ó$¸¢¯¼£¯À¤¯Ä¥¯ ø ¼e’‚™µ& ø D$£*!°@¼¦ÿ`s&‚r‚D$™¢*  !(@†™Ä$!(Àæÿ@!0@‚!(ÀD$ ø áÿ‚*ÿE$„™„$(ÿ!(‚¢ÿF$‚ÿE$Â,ƒÿ@Š„™š ø „$¼xÿ„™.„$ ø .dÿÂ,oÿ@Š„™š ø „$¼dÿ„™„$ ø !( ¼¸þ<œ'!à™Ðÿ½'(¿¯$±¯ °¯¼¯…™ˆ¥$$‘ ø !€€¼@! ‚ E$$4"$:"$,"$:"!0 „™(¿$± °„$ 0½'…™Œ¥$ ø $¼ @‚åÿ E$„™„$(¿$± ° 0½'„’’’™±¯ ø „$¼(¿$± °à0½'„™êÿ„$„™(¿$± °„$ 0½'„™Þÿ„$„™Úÿ„$<œ'!à™¨ÿ½'T¿¯P¾¯L·¯H¶¯Dµ¯@´¯<³¯8²¯4±¯0°¯¼¯ƒ‘b$eŒGŒ0& HCªª%ºº¢ ¢ÒŒ!¸€F@!ð ™ ø ! ¼! @™ ø !˜@B!Sq&S$*3¼@ "*@!°ƒb$Tu” µ§"´£B’R& ¢£C’™!££!€6 ¤'1&!( ø $*3¼ $*¢`R&ëÿ€™! àÆ'!8  ø $¼!¨@! T¿P¾L·H¶Dµ@´<³8²4±0°àX½'™!0$ ø  $¼ìÿ@!¨@3Ž!ˆ*S‚ `”R$”!Q™E€1& ø „&*3¼øÿ`!Q™ ø  $c*¼Óÿ`(³¯B’B$*bÎÿ@! $E’$ÿ£0Rbb((@$ô~„™F’„$ ø ÿ¥0C’¼ `!€”!P™E ø „&C’&*¼÷ÿ`!P™ ø  $¼™! @ ø (¥'¼Õÿ@!@Ÿÿ! Úÿb„™ ø „$E’¼¢,Þ@E’á è¾$ê¹ÿ$Þ¢„™„$ ø E’¼¢,×ÿ@„™„$ ø ÿÿ¥$Îÿ„™ ø „$E’¼¢,@„™ ø „$½ÿ„V’™„$ ø !(ÀC’¼Q&þÿt$rÀ!€‚B$WŒE ‚*‚E$``v~„™„$ ø !0`¼,$™ ø 1&¼„™ ø „$!Èà ø ! ¼,$™ ø 1&¼„™ ø „$¼! ‚™ôE$ ø $¼.@!Èà„™ ø „$¼&™ ø  $*¼1&)`ôÿ”& ‚*&@™ ø  $¼! ‚™ˆE$3’ ø $¼¬ÿ@! ‚™ŒE$ ø $¼8@‚¤ÿE$ ø ! Õÿ„™ ø „$¢ÿÐ#(Є™„$ ø €0¼8ÿ€„™„$ ø !(€/ÿ„™ ø „$Šÿ„™ ø „$E’¼¢, ÿ@„™ ø „$ÿ„%’&’'’™³¯ ø „$oÿ„™ ø „$ÿ„™'ÿ„$„™„$"ÿÿ$„™„$ÿ$„™„$ÿ$<œ'!à™Ðÿ½',¿¯(²¯$±¯ °¯¼¯ÐŒ!ˆ M!€…™¥$ ø ! ¼@ ¯™ %Ž! @¦' ø $¼!€@!,¿(²$± °!`à0½'…™¥$ ø ! ¼èÿ@…™¥$ ø ! ¼<@$…™¥$ ø ! ¼4@$…™¥$ ø ! ¼@$…™¥$ ø ! ¼ @$…™!  ø ¥$¼Êÿ@ÿÿ$$¾ÿ¢¯™¥Œ¦' ø $¼¾ÿ@!€@£$b `$¶ÿb„™ ø „$¼¯ÿ!¤ÿ¢¯„™ ø „$¼¥ÿ!„™ ø „$¼ÿ!<œ'!à™ˆÿ½'t¿¯p¾¯l·¯h¶¯dµ¯`´¯\³¯X²¯T±¯P°¯ ¼¯™|¥¯H ¯Ó$u$H¦'$ ø x¤¯ ¼‹@!@bŽÿÿ$s&†@!€@…™¥$ ø ! @ ¼ @!ð…™!  ø ¥$ ¼£@$H¢@ªÀ$‚—C$DŒeŒâ& fg hD¨E¨ F äºE¸G  H |¢™x¤EŒæ& ø  $ ¼„T@!@‚$QˆRˆ TˆUˆ‘˜ U˜R˜T˜(±¯,²¯0´¯4µ¯pŽas&H¢é@WÀ‚çE$™!( ø !0!@ÿÿB$B, ¼‰@ðÿ$Â’C2$‚%C¢bŽs&`@!€@!Àâ&„ƒ$…ŒfŒ dg hE¨F¨ D åºF¸G  H ™ ø ä& ¼ÄŠƒÄš‘c$!CD¨D¸|¤™ …Œx¤æ& ø  $ ¼!@t¿p¾l·h¶dµ`´\³X²T±P°!`àx½'ƒÿÀ‚—C$EŒfŒâ& dgE¨F¨ D åºF¸„ÿG …™¥$ ø !  ¼ @!°…™¥$ ø !  ¼ð@$8±¯<²¯@´¯Dµ¯bŽ€ 8£'!€@!°d¢ÿ@s&qŽñ s&…™¥$ ø !  ¼'@…™¥$ ø !  ¼@…™¥$ ø !  ¼@…™¥$ ø !  ¼ @! …™ ø ¥$ ¼Ë@Â’nÿïB0Â’kÿB4…™¥$ ø !  ¼Uÿ@! …™¥$ ø !  ¼ @! …™¥$ ø !  ¼ˆ@! …™¥$ ø !  ¼¹@! ™!( ø !0ÿÿ4!ˆ@+b ¼¹@!8ÿÿ#2¢=ÿâ™!( ø !0! @B, ¼Ã@Ã’ðÿ$$Dc0%C-ÿ¢‚E$„™ ø „$ ¼!°$!¸(³'b’c’h’%C„`1*C™„$e¢vb¢ ø  ¼h’b’c’„i’%ˆC‚ÿ1™…$!0!8 !(åD$±¯51¡  ø 1 ¼2‚™!(À!0!8@D$µ¯´¯ ø ±¯ ¼(¾‚™0žÿÿ¥$ÿÿÆ$@9Ö& ø D$Ã* ¼s&¿ÿ`÷&!ÿ!@„ƒ$…ŒfŒ dgE¨F¨ D åºF¸âþG ™!( ø !0!¨@B, ¼]@!8Â’ðÿ$£2$‚%C½þ¢‚‘ÿE$…™¥$ ø !  ¼ ÿ@$…™!  ø ¥$ ¼ÿ@$Òþÿÿ$„™‡Œ„$„$ ø $ ¼Çþÿÿ$‚„GŒ™„$ ø %$õÿ‚…™DŒ¥$ ø !0 ¼´þÿÿ$‚…™DŒ¥$£¯!0  ø  ¼¨þÿÿ$‚…DŒ™$¢¯¥$!0@ ø $òÿ‚…DŒ™$¥$!0€!8æÿ¢¯‚…DŒ™$¥$!0 Ýÿ¢¯<œ'!à™°ÿ½'H¿¯D·¯@¶¯<µ¯8´¯4³¯0²¯,±¯(°¯¼¯™!° !ˆÀu$ ¦'$ ø !¸€!€@¼s ¢˜@!(’™S&! ` ø  $¼1&ƒb$dŒFŒEŒdªeª fªDºeºfº$Žb€1&™!( ø !0$Ž!€@¼N€ÿÿ$™1&!( ø !0$Ž!¨@¼D€ÿÿ$™1&!( ø !0$Ž! @¼:€ÿÿ$™!( ø !0$Ž!@¼1€ÿÿ$™!( ø !0%´%r%b!@@þÿ$ùÿ$$d$%b¼R`ÀÂ!`B0c0€ %b„0@% ƒ™B0%D1! ` ø %€¼! àƒ™‘c$!CP¨P¸ ÅŽ!0` ø  $!€@¼!H¿D·@¶<µ8´4³0²,±(°àP½'™ÅŽ! à!0` ø  $!€@¼ìÿgŠ„Gš™â0è0C`å0æ0ç0²¯¨¯„$)Â0 ø ‚8¼Øÿ!„™ÅŽ ø „$¼Ðÿÿÿ$„™ÅŽ ø „$¼Èÿÿÿ$<œ'!à™Àÿ½'<¿¯8¶¯4µ¯0´¯,³¯(²¯$±¯ °¯¼¯‘™2&!€À!°€ $! @!¨  ø !(¼&ƒdŒb$FCEDª$ºC¢E¢F¢ŽK€&™!( ø !0Ž! @¼8€ÿÿ$™&!( ø !0Ž!˜@¼.€ÿÿ$™!( ø !0Ž!ˆ@¼%€ÿÿ$™!( ø !0! @%“%Q%Dþÿ$$C¼>@@€™€%€À%€! @ ø %€¼! Àƒ™‘c$!CP¨P¸ ¥Ž!0@ ø  $¼!€@!<¿8¶4µ0´,³(²$± °à@½'™¥Ž! À!0@ ø  $!€@¼íÿEŠ™%šÃD0¤¯„C0ƒ8„$¥0Æ0 ø ç0¼Ûÿ!„™¥Ž ø „$¼Óÿÿÿ$<œ'!à™¸ÿ½'@¿¯<³¯8²¯4±¯0°¯¼¯( ¯Ð$‚ŽS$!€- ÿÿ$…™¥$ ø ! ¼@!…™¥$ ø ! ¼ @$…™¥$ ø ! ¼@$Ž*€!(™ £¯ ø !0¼! @™!(` ¦'$øn9' ø $¢¯¼!€@!@¿<³8²4±0°àH½'…™¥$ ø ! ¼Þÿ@$‚…™DŒ¥$ ø !0 ¼èÿÿÿ$™(¢'! @!(` ¦'$ £¯Ì#9' ø ¢¯!€@¼Úÿ(¢„™FŒ„$ ø !( ¼Ðÿ!<œ'!à™°ÿ½'L¿¯H¾¯D·¯@¶¯<µ¯8´¯4³¯0²¯,±¯(°¯¼¯ÃŒ!À!¸€ `!€ ÂŒ@ ÂŒ@! `‚„GŒ™„$$ ø $¼L¿H¾D·@¶<µ8´4³0²,±(°ÿÿ$àP½'™!( ø !0!˜@Àÿ$$b¼«@!0`™DŽ ø !ˆ@B(¼«@"*²@™ DŽ ø $¼ŽCýÿ5& DŽ­€™ ø @*C¼­@$ BŽo@™¶& ø ! À¼©@! @™!( ø ! @$¼ PŽ:$“® ‘¢‚®‘&!˜’™¢£’¤'££ £!( ø $c*s&"¢¼d*&6`1&íÿ€ ‘&PŽ ! ³'’™ ¢£’R&!££" £! `!( ø $*U"¢¼&ðÿ`1&…™! à!8À!0€øn9' ø ¥$¼!€@™ ø ! €!¼L¿H¾D·@¶<µ8´4³0²,±(°àP½'’Èÿ^&™ ø ! €¼$‚„GŒ™„$ ø $Sÿ‚…™DŒ¥$ ø !0 ¼‰ÿ‚„GŒ™„$$ ø  $?ÿ‚…DŒ™¥$ ø !8`6ÿ‚…DŒ™¥$ ø $-ÿ‚…DŒ™¥$ ø $$ÿ‚…DŒ™¥$ ø !0 ÿ‚„GŒ™„$ ø .$ÿ‚„GŒ™„$$ ø $ÿ<œ'!à™…™49' ¥$<œ'!à™…™49' ¥$<œ'!à™¨ÿ½'T¿¯P¾¯L·¯H¶¯Dµ¯@´¯<³¯8²¯4±¯0°¯¼¯…™ ¢'¥$!0!8Ì#9' ø ¢¯¼f@$¢¯ °„Ž™„$(¢¯ ø !(@$¤(¢¼*‚&!ð^`™ÐŽ ø  $¼!(À‚™ ø D$¼!˜‚™ ø D$¼!(‚™ ø D$¼!€À‚Ö&™Å’ ø D$¼Å’‚™Æ’Ç’ ø D$¼ &‚™ ø D$Ã’¼ýÿt$*@!¸À!@*€t•%’™R& ø ¤&s&C*¼*€t&`1&ôÿ™ ø  $¼éÿ!â’(¤Þ'!V*ĪÿV$‚…™DŒ$¦ ø ¥$¼$¢T¿P¾L·H¶Dµ@´<³8²4±0°àX½'™*€t ø  $¼Æÿ!Üÿ<œ'!à™Ðÿ½'(¿¯¼¯™¥Œ$¢'Ì#9'!0!8 ø ¢¯¼!@„™@„$(¿!`à0½'$¢C ££E!¥£ ¥— ø ¼!(¿!`à0½'<œ'!à™xý½'„¿¯€¾¯|·¯x¶¯tµ¯p´¯l³¯h²¯d±¯`°¯¼¯™¥ŒX¢'!0!8Ì#9' ø ¢¯¼!@ž;@Ò'X¦ ¶'!8À0È$ˆÈ Ĉň˜ØĘ ŘÆ$â¬ã¬ä¬ å¬òÿÈç$ˆȘØâ¬㬠¦—$+“†™$§! @Æ$ ø e&¼!R†™(§! @Æ$ ø e&¼!B†™,§! @Æ$ ø e&¼!B†™0§! @Æ$ ø e&¼!B†™`§! @Æ$ ø e&¼!B†™d§! @Æ$ ø e&¼!B†™•h§! @Æ$ ø e&£&¼p±’!B†™Q¢P¢8§R&! @Æ$ ø e&¼!B†™Ü§! @Æ$ ø e&¼!B†™@§! @Æ$ ø e&¼!B†™D§! @Æ$ ø e&¼!B†™L§! @Æ$ ø e&¼!B†™P§! @Æ$ ø e&¼!B†™Q¢P¢Ô§R&! @Æ$ ø e&¼!B†™<§! @Æ$ ø e&¼!B—™X§! @e& ø æ&¼!B†™\§! @Æ$ ø e&¼!B†™Ð§! @Æ$ ø e&¼!BØ£…Ô¢™Q¢P¢È¦R&̧! @£¯¥$ ø ¢¯¼ø£!B…袙à¦ä§£¯! @¥$ ø ¢¯¼!B†™ô§! @Æ$ ø e&¼!B†™p§! @Æ$ ø e&¼!B†™t§! @Æ$ ø e&¼!B†™x§! @Æ$ ø e&¼!B†™|§! @Æ$ ø e&¼!B†™Ü§! @Æ$ ø e&¼!B†™€§! @Æ$ ø e&¼!B†™Q¢P¢„§R&! @Æ$ ø e&¼!B†™ˆ§! @Æ$ ø e&¼!B†™Œ§! @Æ$ ø e&¼!B†™§! @Æ$ ø e&¼!B†™”§! @Æ$ ø e&¼!B…ü¢Q¢P¢™R&ì¦ð§! @¥$ ø ¢¯¼!B†™l§! @Æ$ ø e&¼!B†™˜§! @Æ$ ø e&¼!B†™œ§! @e& ø Æ$¼!BƒQ¢eŒP¢c$R&EªbŒEºdBª”Bº„Ð&D¢$R&™Ž! @ ø …&ÿÿ1&¼!B÷ÿ!&¢&P±’†™Q¢P¢ä§R&! @Æ$ ø e&¼!B†™è§! @Æ$ ø e&¼!B†™ì§! @Æ$ ø e&¼!B†™ð§! @Æ$ ø e&¼!B†™Q¢P¢ô§R&! @Æ$ ø e&¼!B†™ø§! @Æ$ ø e&¼!B†™§! @Æ$ ø e&¼!B™X§! @e& ø æ&¼!BƒQ¢bŒP¢c$R&BªdŒBº ebDªDºÜÐ&B¢ E¢$ R&™Ž! @ ø …&ÿÿ1&¼!B÷ÿ!&¢&P±’P¢Q¢†R&™Q¢P¢§R&! @Æ$ ø e&¼!B†™(§! @Æ$ ø e&¼!B†™§! @Æ$ ø e&¼!B†™Q¢P¢§R&! @Æ$ ø e&¼!B†™ §! @Æ$ ø e&¼!B†™§! @Æ$ ø e&¼!B†™Q¢P¢§R&! @Æ$ ø e&¼!B†™§! @Æ$ ø e&¼!B†™§! @Æ$ ø e&¼!B†™Q¢P¢ §R&! @Æ$ ø e&¼!B†™$§! @Æ$ ø e&¼!B†™ü§! @Æ$ ø e&¼!BQ¢P¢†R&™Q¢P¢$§R&! @Æ$ ø e&¼!B†™(§! @Æ$ ø e&¼!B†™,§! @Æ$ ø e&¼!B†™0§! @Æ$ ø e&¼!B†™Q¢P¢4§R&! @Æ$ ø e&¼!B†™8§! @Æ$ ø e&¼!B†™<§! @Æ$ ø e&¼!B†™@§! @Æ$ ø e&¼!B†™Q¢P¢D§R&! @Æ$ ø e&¼!B†™H§! @Æ$ ø e&¼!B†™L§! @Æ$ ø e&¼!B†™P§! @Æ$ ø e&¼!B†™Q¢P¢T§R&! @Æ$ ø e&¼!B†™X§! @Æ$ ø e&¼!B†™\§! @Æ$ ø e&¼!B†™`§! @Æ$ ø e&¼!B†™Q¢P¢d§R&! @Æ$ ø e&¼!B†™h§! @Æ$ ø e&¼!B†™l§! @Æ$ ø e&¼!B†™p§! @Æ$ ø e&¼!B†™Q¢P¢t§R&! @Æ$ ø e&¼!B†™x§! @Æ$ ø e&¼!B†™|§! @Æ$ ø e&¼!B†™€§! @Æ$ ø e&¼!B†™Q¢P¢„§R&! @Æ$ ø e&¼!B†™ˆ§! @Æ$ ø e&¼!B†™Œ§! @Æ$ ø e&¼!B†™§! @Æ$ ø e&¼!B†™Q¢P¢”§R&! @Æ$ ø e&¼!B†™˜§! @Æ$ ø e&¼!B†™œ§! @Æ$ ø e&¼!B†™Q¢P¢ §R&! @Æ$ ø e&¼!B†™¤§! @Æ$ ø e&¼!B†™¨§! @Æ$ ø e&¼!B†™¬§! @Æ$ ø e&¼!B†™Q¢P¢°§R&! @Æ$ ø e&¼!B†™´§! @Æ$ ø e&¼!B†™¸§! @Æ$ ø e&¼!B†™¼§! @Æ$ ø e&¼!B†™À§! @Æ$ ø e&¼!B†™Q¢P¢Ä§R&! @Æ$ ø e&¼!B†™ §! @Æ$ ø e&¼!B†™Q¢P¢0§R&! @e& ø Æ$¼!B‚Q¢P¢EŒR&™P¢Q¢ ø Ä'¼!„¿€¾|·x¶tµp´l³h²d±`°!`àˆ½'„™„$ ø $¼ìÿÿÿ$<œ'!à™àþ½'¿¯¾¯·¯¶¯ µ¯´¯³¯²¯ü±¯ø°¯ ¼¯™ô ¯¥Œð¢'!0!8¢¯Ì#9' ø !€€ ¼!@žd@Ñ'ð¦(²'!8@ÀÈ$ˆÈ Ĉň˜ØĘ ŘÆ$â¬ã¬ä¬ å¬òÿÈç$ˆ˜â¬(¦—$\Âu$™! ô¦' ø $ ¼@@ÿÿ$‚–—•”!€@S$$$Ž(ŽŽŽ™!0`£¯¤¯Å&!  ø ¢¯ ¼hŽdŽDŽHŽ!ˆ"™¤¯å&!  ø £¯!ˆ" ¼ô¢™ÿÿR&…&s&$@! ™¤Ž!  ø ¥&!ˆ" ¼×ÿA&ƒ™b$D‚fEŒ$¢&¢ ø Ä' ¼!¿¾·¶ µ´³²ü±ø°!`à ½'„ŽˆŽ ø  ¼×ÿ!ˆ"„™„$ ø $ ¼åÿÿÿ$<œ'!à™Ðÿ½',¿¯(´¯$³¯ ²¯±¯°¯¼¯™’ÂŒ!8 ! €P&™!˜ 9@! @!Èà ø ¼!ˆ@‚™C$DŒeªDº¢ ø ! B$!P¼Q¨Q¸™eŽ! €!0 ø  $¼ @!@BŽ„™„$!( @!0@ ø ¼!,¿(´$³ ²±°!`à0½'„!(  ø „$¼ñÿ!„¥Œ ø „$¼êÿÿÿ$<œ'!à™Ðÿ½',¿¯(´¯$³¯ ²¯±¯°¯¼¯™’ÂŒ!8 ! €Q&™!˜ ?@! @!Èà ø ¼!€@ƒ™b$dŒEŒCŒ F #ª$ª%ª#ºDº%º &¢ ø ! B$!Q¼P¨P¸™eŽ! €!0  ø  $¼!(„™„$ @!@,¿(´$³ ²±°!`à0½'F† ø ¼!,¿(´$³ ²±°!`à0½'„¥Œ ø „$¼ãÿÿÿ$<œ'!à™ ÿ½'X¿¯T·¯P¶¯Lµ¯H´¯D³¯@²¯<±¯8°¯¼¯ÂŒ!¸€!° d@$  ¯$ ¯( ¯, ¯C€!@0$ ±'5b!˜™! !( ø $¼! @™ ø ÿÿ$¼1@!€@B0•T,ÿÿ&'b*%@!PG£Ž&&@!CE”£0`¢0@Ðÿæ$¢0-@Éÿæ$ÿÄ0‚,@&Â!bC@#btÿÿ&ßÿ$¢C‚x$ÉÿbÇÿR&ÿÿ$S$ÿÿ$!€X¿T·P¶LµH´D³@²<±8°à`½'#’!C"¢s&1&Áÿÿÿ&™ ø ¼ÎÿÉÿF$„™„$!( ø  $¼ÅŽ™0¢'! à!0!8Ì#9' ø ¢¯¼Óÿ@! @„™’0± ø „$¼$!0b€@!˜™e ø D&¼ÿÿ&òÿ!0™ ø  $¼µÿ!€õÿ`îÿ*S¬ÿ@! à™ÅŽ ¦'øn9' ø $¼¤ÿ! @<œ'!à™Èÿ½'0¿¯,±¯(°¯¼¯  ¯ÂŒ!€ @!ˆ€™ ø ! @! @$¼3‚$‚ÿÿ$!`0¿,±(°à8½'™¥Œ ¦' ø $¼óÿ@!@ ¥ïÿ „™ ø „$¼èÿ!™Ž!  ¦' ø $¼Þÿ@!@ ¢Ûÿ@!`™! $ ¦' ø $¼Ñÿ!@ Ž™ ¯! ¦' ø $¼Çÿ!@<œ'!à™Èÿ½'4¿¯0²¯,±¯(°¯¼¯ÐŒ™!8!0! !ˆ€™¥Œ ¢'Ì#9' ø ¢¯¼™@!@ ¤ ø ¼!4¿0²,±(°!`à8½' ø ! ¼EŽ™! !0øn9' ø G$¼!@4¿0²,±(°!`à8½'<œ'!à™xÿ½'„¿¯€¾¯|·¯x¶¯tµ¯p´¯l³¯h²¯d±¯`°¯¼¯™!ð !ˆÀX ¯u$X¦'$ ø !¸€ÿÿ$¼`$Z@ÿÿ$X¢v@$…0Ž™¥$ ø ! ¼Z@$1&"ŽH@þÿ$™¤'!( ø @$¼2Ž“™! @ ø e&¼ @…™¥$ ø ! @¼@$0Ž`$…™¥$ ø ! ¼ @! …™!  ø ¥$¼/@ $$_°e&™ ø ! @¼I@ÿ$<$%‚£§°§ ¢£4$!££" £™Å! à¦'øn9' ø @$¼!°@!À„¿€¾|·x¶tµp´l³h²d±`°!`àˆ½'…™!  ø ¥$¼ ÿ@$‚„™GŒ„$$ ø $¼áÿþÿ$‚„™GŒ„$ ø -$¼ÿÿ$„¿€¾|·x¶tµp´l³h²d±`°!`àˆ½'…™¥$ ø ! @¼*@<$‚ÿ$%‚£§ $°§°ÿ ¢£™ ø ! @¼[@<$…™¥$ ø ! @¼ @‚ÿ$%ƒ<$¢§ ££ $–$ $!¢£$£§Ü$ÿÿ$°§&¢§4£¯D¤¯" £<¤¯ÿ@¤¯X@! ! c$bŒüÿ@„$‚,O@<$™¢§! @\¥' ø !0¢§\¢¼C€ÿ`1&$Ž™\¥' ø !0 ¢£\¢¼C€uÿ`1&$Ž™\¥' ø !0!¢£\¢¼C€iÿ`1&™$Ž\¥' ø !0¼"¢£\¢C€Sÿ`!À[ÿÿ$¢§4$%ƒ!¢£Ð$< ££&¢§Ð€$˜<E„4 N$$£§€–B4ÿÿ$°§,¥¯0¢¯4£¯D¤¯" £(¥¯<¤¯7ÿ@¤¯„™Ž„$$ ø $¼Ž„™„$$ ø $¼Ž„™„$$ ø $$¼Ž„™„$$ ø )$¼Ž„™„$$ ø *$¼Ž„™„$$ ø +$¼ÿþÿ$£@! ! c$bŒüÿ@„$ ‚,š@<$™¢§! @\¥' ø !0¢§\¢¼C€õþ`1&$Ž™\¥' ø !0 ¢£\¢¼C€éþ`1&$Ž™\¥' ø !0!¢£\¢¼C€Ýþ`1&$Ž™\¥' ø !0"¢£\¢¼C€Ñþ`1&$Ž™\¥' ø !0$¢§\¢¼C€Åþ`1&$Ž™\¥' ø !0&¢§\¢¼C€¹þ`1&$Ž™\¥' ø !0(¢¯\¢¼C€­þ`1&$Ž™\¥' ø !0,¢¯\¢¼C€¡þ`1&$Ž™\¥' ø !00¢¯\¢¼C€•þ`1&$Ž™\¥' ø !04¢¯\¢¼C€‰þ`1&$Ž™\¥' ø !0<¢¯\¢¼C€}þ`1&$Ž™\¥' ø !0@¢¯\¢¼C€qþ`1&™$Ž\¥' ø !0¼ÿD¢¯„™Ž„$$ ø $¼Ž„™„$$ ø $¼Ž„™„$$ ø $$¼Ž„™„$$ ø )$¼Ž„™„$$ ø *$¼Ž„™„$$ ø +$¼Ž„™„$$ ø "$¼Ž„™„$$ ø "$¼Ž„™„$$ ø )$¼Ž„™„$$ ø )$¼Ž„™„$$ ø $$¼Ž„™„$$ ø $$¼Ž„™„$$ ø "$¼Ž„™„$$ ø $¼Ž„™„$$ ø $¼ïýþÿ$‚„™GŒ„$$ ø $¼äýþÿ$<œ'!à™¸ÿ½'@¿¯<³¯8²¯4±¯0°¯ ¼¯™!ˆ (¦'u$$ ø !€€ ¼@ÿÿ$(¢@,¢'‚„™GŒ„$$ ø -$ ¼ÿÿ$@¿<³8²4±0°!`àH½'™%Ž! !0!8Ì#9' ø ¢¯ ¼îÿ@!@,²„™EŽ ø „$CŽ ¼`!ˆ“!€@’’£0C’£¯’™8B0⯒d&`c0C ø £¯CŽ1&*# ¼êÿ`&!@¿<³8²4±0°!`àH½'<œ'!à™xÿ½'€¿¯|³¯x²¯t±¯p°¯¼¯™! !€Àu$`¦'$ ø !ˆ€¼! ã@ÿÿ$`¢ç@&Žõ@!c$bŒüÿ@„$‚,í@ ³'™! `!( ø @$¼Ž™d¥' ø !0(¢£d¢¼C€Ò`&Ž™d¥' ø !0)¢£d¢¼C€Æ`&™Žd¥' ø !0*¢£d¢¼C€»`ÿÿ$™EŽh¢'! !0`@$Ì#9' ø ¢¯¼@!@h°$–ï–<b,ò@ŽC0Üf×`$Þb‚F$’„™¥0„$ ø B(¼’„™ ’ ’ ø „$ †¼Å`ÿe0‚F$„™ ø „$¼–„™ ø „$¼Ž„™ ø „$¼Ž„™ ø „$¼Ž„™ ø „$¼Ž„™ ø „$¼ Ž„™ ø „$¼$Ž„™ ø „$¼(Ž„™ ø „$¼,Ž„™ ø „$¼0Ž„™ ø „$¼4Ž„™ ø „$¼8Ž„™ ø „$¼<–„™ ø „$¼>–„™ ø „$¼™ ø  $¼!€¿|³x²t±p°!`àˆ½'‚„™GŒ„$$ ø -$¼ÿÿ$€¿|³x²t±p°!`àˆ½'„™Ž„$$ ø $¼Ž„™„$$ ø $¼Ž„™„$$ ø ,$¼Ž„™„$$ ø -$¼Ž„™„$$ ø .$¼þÿ$€¿|³x²t±p°!`àˆ½'‚-ÿF$‚*ÿF$‚=ÿF$‚$ÿF$„™„$ ø $¼³ÿÿÿ$„™„$!0` ø <$öÿ<œ'!à™Ðÿ½'(¿¯¼¯™  ¯¥Œ ¢'!0Ì#9'!8 ø ¢¯¼!0@™…! ™ @¥$ ¤!È` ø ¼(¿!à0½'‚DŒ ø ¼(¿!à0½'<œ'!à™¸ÿ½'@¿¯<µ¯8´¯4³¯0²¯,±¯(°¯¼¯Ñ$ÒŒ‚&ŽT$3À!˜€¢Œ%@ÿÿ$™!(@¦' ®9' ø $!ˆ@¼@!@‚“U$!€²'!PC™3e0&5`d& ø !0€*¼óÿ`!P™ ø  $¼! @¿<µ8´4³0²,±(°!`àH½'!€! c$bŒüÿ@&þÿ&B,@*@! À„™„$ ø !(¼ÿÿ$@¿<µ8´4³0²,±(°!`àH½'Ëÿ!  ™ ¥' ø !0¼¢£„™„$ ø ÿE0 ¢¼C€``1&$ ¥'¢“¢£¢£¢£™! `!(@¦'\Í9' ø $¼³ÿ!ˆ@™$Ž ø !0¼¢£„™„$ ø ÿE0 ¢¼C€-`1&™$Ž ¥' ø !0¼¢£„™„$ ø ÿE0 ¢¼C€#`1&™$Ž ¥' ø !0¼¢£„™„$ ø ÿE0 ¢¼C€Âÿ`1&„™%Ž ø „$¼•ÿÿÿ$„™%Ž ø „$¼ÿÿÿ$„™%Ž ø „$¼…ÿÿÿ$„™%Ž ø „$¼}ÿÿÿ$<œ'!à™¸ÿ½'@¿¯<³¯8²¯4±¯0°¯¼¯Ð$( ¯Ž‚!˜€™! `R$`ÿÿ$ ø !ˆ@B,¼@ÿÿ$ ±£Ž™! `!(@ ¦'`$ ø ! `¼! `™!(@ ¦'$øn9' ø !¢£¼!€@!0@¿<³8²4±0°!ÀàH½'™(¢'Ì#9' ø ¢¯¼Â‡„™„$!( ìÿ!0(¢F ø ¼äÿ!0<œ'!à™¨ÿ½'T¿¯P¾¯L·¯H¶¯Dµ¯@´¯<³¯8²¯4±¯0°¯¼¯\¥¯°Œ…™X¤¯  ¯¥$!  ø !˜À!¨!ð!°¼¡@! ‚´T$™ ¢'X¤!(!0!8Ì#9' ø ¢¯¼h@!@ ¢s&EŒcŽ-$š`(¥¯b€+$’D!`Wÿÿ$™! @$¥' ø !0!€@$¢¼C€]`Ž!ˆ! !”™DŒ1& ø !(@À ¼L@!”pŒôÿ!”’„™GŽ„$$ ø E$¼GŽ„™„$$ ø 2$Ž¼!!ˆ“– ! DŽgŒ ø 1&À !”!¨PŒ¼!”™e&ñÿ!0DŽfŒÅ& ø 1&À !”!¨PŒ¼ñÿ!”™EŽ ø  $¼!T¿P¾L·H¶Dµ@´<³8²4±0°!`àX½'¸ÿbŽC€#w%ðÐs&cŽ†ÿ`(¦'(¢\¹'%$b™%~X¤(£¯øn9' ø $¼×ÿ!@…™¥$ ø ! ¼\ÿ@‚YÿŒT$qÿr$Þÿ%°Ð„™ ø „$Ž¼!ˆ€’(¢$P@™D&%Ž ø ¼1&!¨0Žïÿ™ ø  $¼¥ÿ!<œ'!à™¸ÿ½'D¿¯@²¯<±¯8°¯¼¯ÂŒ!€ 6@!ˆ€™¥Œ0¢'!0!8¢¯Ì#9' ø 0 ¯!@¼9@!@( ¯0° (±' ø &¼™ ø ! @¼™! !( ø $¼™íÿ@! 0¥„#(™„$ ø ƒ(!@¼D¿@²<±8°!`àH½'™! @ ø  ¥'¼ @ÿÿ$™Ž!  ¦'øn9' ø $¼!@D¿@²<±8°!`àH½'<œ'!à™Èÿ½'0¿¯,±¯(°¯¼¯ÂŒ!8™n@!0™¥Œ ¢'Ì#9'¢¯‘ ø   ¯¼$&™[@!@ °Ž ø ¼Ž„™ ø „$¼Ž„™ ø „$¼ Ž„™ ø „$¼Ž„™ ø „$¼Ž„™ ø „$¼Ž„™ ø „$¼Ž„™ ø „$¼ Ž„™ ø „$¼$Ž„™ ø „$¼(Ž„™ ø „$¼,Ž„™ ø „$¼Ž™ ø $&¼!0¿,±(°!`à8½'„ ø „$ôÿ<œ'!à™Ðÿ½',¿¯(°¯¼¯ÂŒ—@ ¢'™¥Œ!0!8¢¯Ì#9' ø   ¯¼‡@!@ °„™Ž ø „$¼Ž„™ ø „$¼Ž„™ ø „$¼ Ž„™ ø „$¼Ž„™ ø „$¼Ž„™ ø „$¼Ž„™ ø „$¼Ž„™ ø „$¼ Ž„™ ø „$¼$Ž„™ ø „$¼(Ž„™ ø „$¼,Ž„™ ø „$¼0Ž„™ ø „$¼4Ž„™ ø „$¼8Ž„™ ø „$¼<Ž„™ ø „$¼@Ž„™ ø „$¼DŽ„™ ø „$¼HŽ„™ ø „$¼!,¿(°!`à0½'„™ ø „$óÿ<œ'!à™Àÿ½'<¿¯8²¯4±¯0°¯¼¯ ¯ ¯  ¯$ ¯( ¯, ¯°Œ…™!€¥$!  ø !ˆÀ¼N@ $…™¥$ ø ! ¼8@1&™$Ž ø )¥'¼8@ÿÿ$1&0Ž3…™¥$ ø ! ¼F@! 1&$Ž&€ÿÿ$™1&!( ø !0$Ž¼¢¯€ÿÿ$™!( ø !0$Ž¼$¢¯€ÿÿ$™!( ø !0 ¢¯¼@$$-£¯„™„$ ø !(¼!<¿8²4±0°!`à@½'…! @¥$¦'$¢¯™øn9' ø !@¼<¿8²4±0°!`à@½'…™ ø ¥$¼Þÿ@ÿÿ$$¢¯…! @¥$¦'ãÿ$<œ'!à™ ÿ½'Ø¿¯Ô·¯Ð¶¯Ìµ¯È´¯Ä³¯À²¯¼±¯¸°¯¼¯‚ÃŒ!°€!€À!¸ U$`! !Àc$bŒüÿ@„$ $0€°¦¯™¤'!(  ø !0¼ÿÿ$$s$a$™!( ø ¤'¼TiS ¢'¤ƒ€C’!€ñÿ‘&¢“k@¬§â,{@ÿæ0°¢™ÿB0%0F°¦¯!( ø ¤'¼äÿT°¦™åŽÎ9' ø ! À¼@!€@™åŽ! À¼¯9' ø °¦'¼@!€@°¥2%À„™.6„$. ø 6¼!ؿԷж̵ȴijÀ²¼±¸°àà½'&¢“@¬§ÿâ0ã,0`2°¢“%0°ÿ°¦¯„™.„$ ø .¼Þÿ!‚…™DŒ¨§¥$ ø !0 ¼ÿÿ$!ؿԷж̵ȴijÀ²¼±¸°àà½'‚…™DŒ¨§¥$ ø !0 ¼êÿÿÿ$‚…™DŒ¥$ ø !0 ¼àÿÿÿ$‚…™DŒ¥$ ø !0 ¼Öÿÿÿ$<œ'!à™Ðÿ½',¿¯(²¯$±¯ °¯¼¯! …™¥$$ ø !€€¼ @! …™¥$ ø $¼(@™& ø ! B0¼(@‚@!ˆ™!(¤' ø $¼¤'™ £!(€ ø $!Qb &¼‚íÿ@1&! ,¿(²$± °à0½'„™ ø „$¼óÿÿÿ$„™ ø „$¼ëÿÿÿ$<œ'!à™Àÿ½'<¿¯8¾¯4·¯0¶¯,µ¯(´¯$³¯ ²¯±¯°¯¼¯Ò$PŽ}!ð€…‚™¥$!  ø W$¼ @! …™ ø ¥$¼Ç@ÿÿ$‚™Q$ ø ! ¼!( ™!0@ ø ! ༙ ø ! ¼!W™!  ø @ ¼QŽ™!W! p$ ø T$¼! ™!(  ø !0@¼! ™ ø R&DŽ!ˆP!T¼T$3&¡€0&™!( ø !0b®R&DŽ¼Ÿ€‚|}U$!È  ø !(ÿÿ$¼!@"®~Vÿÿ$B$b®DŽ•€!€!È  ø !( b®¼qVÿÿ$'Ž™!8G!8ô! À!0à<¿8¾4·0¶,µ(´$³ ²±°ç$$ @½'…™¥$& ®9' ø  $!¨@¼Q@! @„™Ž ø „$Ž&¼Ò&E`!(ž—™´$Ä' ø !(€¼EŽ‚™FŽ ø D$CŽ¼Q& `!€“!0™E ø d&CŽ&+¼÷ÿ`!0‚™ EŽ ø D$CŽ BŽ¼!ˆr @!€“!0™E ø d& CŽ&+¼÷ÿ`!0™ ø ä&CŽ DŽÂŽ!d!C+‚¼!(€¿ÿ@r$!  <¿8¾4·0¶,µ(´$³ ²±°!€à@½'„™ ø „$¼ìÿÿÿ$„™ ø „$¼äÿÿÿ$„™ ø „$¼Üÿÿÿ$<œ'!à™Ðÿ½',¿¯(²¯$±¯ °¯¼¯Œь%@!€™ ø ! @+C,¢¯¢¯¼`ÿÿ$™! @Û$¦' ø $¼8@!€@™¦! @Î9' ø !( ¼'@!€@!,¿(²$± °à0½'™!( ¼¯9' ø ¦'!€@¼òÿ¢“@‚D$™ ø ¼,¿(²$± °!à0½'‚òÿD$„™„$ ø !(¼Ôÿ!„™„$ ø !(¼Ìÿ!<œ'!à™àÿ½'¿¯°¯¼¯‚…FŒ‚™!€€DŒ ø ¥$¼™ ø ! ¼™ ø ¼DŒ™ ø <œ'!à™°ÿ½'H¿¯Dµ¯@´¯<³¯8²¯4±¯0°¯¼¯™!˜€!¨ $! À$!0`°“ ø !à¼!ˆ@„-@„$™¢'$°£´¯ ²¯! b®!0`µ¯ ø ð‰4¼!€@™@!  ø !¼H¿Dµ@´<³8²4±0°àP½'òÿ  ø þÿ$!¼H¿Dµ@´<³8²4±0°àP½'™„9' ø ¼Íÿ<œ'!à™Øÿ½' ¿¯¼¯™…9' ø  ¯¼ ¿à(½'<œ'!à™Øÿ½' ¿¯¼¯™$…9' ø ¢¯¼ ¿à(½'<œ'!à™Øÿ½' ¿¯±¯°¯¼¯!ˆ€ ø ¼ @!&Ž™!( öÿ@! @!€! ¿±°à(½'<œ'!à™¨ú½'T¿¯P¾¯L·¯H¶¯Dµ¯@´¯<³¯8²¯4±¯0°¯¼¯\¥¯  ¯$ ¯£Œ”¢$ƒ® ¯\¢¯ ¯  ¯$ ¯( ¯, ¯0 ¯4 ¯¢Œ!€ @!ˆ“¶'r&Hµ'X·'8¾'™\¤'$¦' ø  ¥'¼!@™¤'o@$$¢@ ¢$@!(@\¢CŒèÿ`$¢@\¢DŒ€Dÿÿ$="þÿ$4"! T¿P¾L·H¶Dµ@´<³8²4±0°àX½' ø \¢¼CŒÃÿ`Úÿ™Ô†9' ø ¼(@!€@‚™DŒ!( ø ¼! T¿P¾L·H¶Dµ@´<³8²4±0°àX½'™ ø ¤'¼îÿ! ‚™DŒåÿ!(‚™DŒ ø !(àÿ\¢„™…ŽFŒ ø „$¼Øÿ! ÿÿ$žÿb¢“@@™ ø ¤'¼´@‚…™DŒ†Ž ø ¥$¼™ ø $ E–dŽBŽCŽD¥§…™8¤¯<¢¯@£¯ £¥$ ø 8¤'¼‚@!@™!  è$ ø !0@¼u@!  ™è$ ø !0@¼n@‚„S$™!  è$ ø !0@¼c@ƒH¢ƒeŒ@(µ¯!EC” c0 `!  ‚$(¢¯C€! @@!eb” B0÷ÿ@‚$…™¥$ ø (¤'¼Ûÿ@!€@™! À!(@ ø $¼$™$ ø !0¼a@!ˆ@™! à!( ø Ä$¼$™!(! À$X¢¯ ø H·¯¼! ™F‰4 ø !0À¼(@!€@™0¤'\¥' ø $¼™ ø ! ¼ 0¤'‚™E$ ø $¼@žÿÀ¢™ ø ! À¼øÿ@™ ø ! @¼¢“Uÿ™ ø CŒ$¼b!È`Öÿ0 £„ ø „$¼Ðÿ0 £\¢™DŒÔ†9' ø ¼@!€@Ž\¦¤' ø !(¼Ìþ!ˆ@„!È` ø „$¼šÿïÿ<œ'!à™‡‹ÿâ0!KC!@€ c0!` ! `%‘ÿâ0!DC c0÷ÿ`+$=b-$?b(À$0$<b $!P`+† ©ÿD$ÉÿD$+†@F%‘!PDÿâ0!KC&&Db0i0Ðÿ„$éÿ@c0€#P  ¨¬à!@íÿÂ!P0$èÿbx$bX$ãÿbÿâ0%‘Þÿ!P%‘Ãÿ%‘¿ÿ $x$bX$b%‘¼ÿ$%‘¸ÿ$<œ'!à™™!(  $<œ'!à™Èÿ½'0¿¯,µ¯(´¯$³¯ ²¯±¯°¯¼¯!¨€(€!  ' ! ™ ø !  ¼!  ™ ø !˜@#SR$¼ @!€™!ˆ°! €!(  ø !0`&¼@*õÿ`0¿,µ(´$³ ²±°!à8½'! 0¿,µ(´$³ ²±°à8½'! 0¿,µ(´$³ ²±°à8½'<œ'!à™Øÿ½' ¿¯±¯°¯¼¯™!€€ ø !ˆ ¼! P™ ø !( !¼ ¿±°à(½'<œ'!à™Øÿ½'$¿¯ ²¯±¯°¯¼¯™!€!€À ø !ˆ !R¼! pd!@"’1&b úÿ@c$!@$¿ ²±°à(½'<œ'!à™Øÿ½'$¿¯ ²¯±¯°¯¼¯!€(¤¯! !€$™! `(¥' ø $(£! ‚ bc$¼&@(£¯ñÿ:$¿ ²±°B,à(½'<œ'!à™Èÿ½'4¿¯0°¯(¼¯†‰‡‚ƒˆ¦¯†™!€ ¢¯£¯¨¯ ©¯!  Æ$ ø $!(¼4¿0°à8½'<œ'!à™Ðÿ½',¿¯(°¯ ¼¯†‡‚ƒ¦¯†™!€ ¢¯£¯!  Æ$ ø $! ¼,¿(°à0½'<œ'!à™ÿÆ0  ÿÿ£$‚ÿÿ$P E$‚ÿÿc$&Â!EFúÿg„$à!À<œ'!à™!@€ÿÿÃ0 ÿÿ§$‚ÿÿ$PE$‘ÿÿç$&bÿB0@!ED”&döÿæ%à!`<œ'!à™ƒ$üÿ$!@€$Hbðÿ½'# $+ #`¤!8À@«'‚PE$‘%&GÿB0€!EDŒ+ öÿ@&8düÿ$$‚!HH+ *`‚1‚PJ$2c­¢“ £“&GÿB0€!JEŒ ¤“&8Å&gÿc0€!jeŒ&8E& ‡ÿ„0€ ! Š…Œ ¢“&8e&GÿB0€!JDŒ%+ Üÿ@&8d‚1!HH+ `!à‚PE$‘%&GÿB0€!EDŒ+ öÿ@&8d!àà½'¦Œ!@Â(@!8€‚#ÂD$þÿc$* Ä!â €f(G$£¬À!@àâB$*b@!@à!¢( @!8€à!#¤þÿE$! ä£( `‡$âäøÿF#¤‚$*¢óÿ@!àà!à¢(@!8€âè#¢!HâB$*P¢+ Èþÿe$ €¢(óÿ@'%à!ûÿ@à!àà!<œ'!à™Øÿ½'$¿¯ °¯¼¯ÿÿ„0†ð‡0‚,‰0ÿˆ0ðƒ0!€ !  ™Æ$9@$†$Æ$! $bP$A$ ø ¨¯!¼$¿ °à(½' ø ©¯!¼$¿ °à(½'<œ'!à™Ðÿ½',¿¯(´¯$³¯ ²¯±¯°¯¼¯™!ˆ€ ø $!@+‚¼@“™0‚!(  ¢þR& ø d&#&+’0¢¼ôÿ@!ˆ`™! ,¿(´$³ ²±° 0½'<œ'!à™Èÿ½'4¿¯0¶¯,µ¯(´¯$³¯ ²¯±¯°¯¼¯L°!°€.!¨ ! À!ˆàH²@!˜"Ž!  @!(€&Ž!ÈÀ ø ¼&Ž™! @!( ø !8@!@¼ 1&`+P@ÿÿ&#€!˜c.åÿ@!C!`4¿0¶,µ(´$³ ²±°à8½'<œ'!à™Ðÿ½',¿¯(´¯$³¯ ²¯±¯°¯¼¯™!€€!˜À!à ø !  !(P$@¢¼!ˆ!0@+Q™! @ @!,¿(´$³ ²±°!`à0½' ø ¼! P™!(€ ø !0`! ¼,¿(´$³ ²±°!`à0½'<œ'!à™ÿ„0gÿ„$)‚($@ÿÿ4€‚@ B$! ‚ƒ”B!be  ÿÿc0à!`€!E(„$íÿ@(€!E(„$÷ÿ€@(æÿ<œ'!à™ÿÿ…0¢,!@!]¢,@™$€!E@(]£,ûÿ`Øÿ%‚!0I$ÿæ0'Â,@!È@!id”b”#DÂ!CC! ‚+ ¤ðÿ€Ç$!ÈÿC0à!`!0  !8!‡C$CÆ$ýÿ`ÿÿb$ç$+åõÿ@à!À<œ'!à™Øÿ½'$¿¯ °¯¼¯‚ÿÿˆ0ƒI$ð1 $g$!€ !P ‚ÿ1‚G$ 1 $‚1$"‚! …™ª¯©¯!  ø ¥$!¼$¿ °à(½'ƒ$¢i$‚…I$™ª¯©¯! þÿÆ$ ø ¥$!¼$¿ °à(½'‚…J$™ª¯©¯ ø ¥$!¼$¿ °à(½'ÐÿÆ$<œ'!à™¸ÿ½'D¿¯@¾¯<·¯8¶¯4µ¯0´¯,³¯(²¯$±¯ °¯¼¯™¥' $ ø !€€¤¼!ˆ@!ð!˜! !5!áB,2@".@ $$!€€„€$I€$™ ø ŸÿC$b,¼@€ƒP c$!CDŒ! œ€F€H`ÿÿ$&‚€ÿÿ$ãÿB` $O¢€`!"@%6!D¿@¾<·8¶4µ0´,³(²$± °!`àH½'ßÿ`$Ýÿ$ÚÿÀ™‚ ø $a$¼C $Ðÿ$%6%U%WÿÿC0D¿@¾<·8¶4µ0´,³(²$± °!`àH½'½ÿ`ÿÿ$¼ÿ&™‚ ø $l$¼C$$ â$".@þÿ#&!!ˆ` $¨ÿ$³ÿ€!¶ÿÞ".öÿ@#&ôÿ!AC_BEAC_BKAC_VIAC_VOÿÿÿÿÿÿ§KÞ Ñ"á$'a)Ô+m.-14-7r:é=”AwE”IñMRsW¢\bïgnžt‡{Ù‚™ŠÐ’ƒ›º¤|®Ó¸ÇÃ`Ϫۮèxö%ŽÿÿŽÿÿ ŽÿÿEÿÿŽÿÿõÿÿPò¬9ÏÿÿÏÿÿÏÿÿåÎÿÿÉÎÿÿ©ÎÿÿÑÒÿÿÁÒÿÿ±Òÿÿ¡Òÿÿ‘ÒÿÿQÒÿÿPòyæÿÿYæÿÿ9æÿÿæÿÿååÿÿ…íÿÿ­ëÿÿ­ëÿÿ­ëÿÿ­ëÿÿeëÿÿ­ëÿÿAëÿÿ…íÿÿ­ëÿÿ­ëÿÿ…íÿÿ­ëÿÿ­ëÿÿ­ëÿÿ­ëÿÿ­ëÿÿ­ëÿÿ­ëÿÿ­ëÿÿ­ëÿÿeëÿÿ­ëÿÿAëÿÿ­ëÿÿ­ëÿÿ­ëÿÿeëÿÿ­ëÿÿAëÿÿ­ëÿÿ­ëÿÿ­ëÿÿ­ëÿÿ­ëÿÿ­ëÿÿ­ëÿÿ­ëÿÿ­ëÿÿ­ëÿÿ­ëÿÿ­ëÿÿ­ëÿÿ­ëÿÿ­ëÿÿ­ëÿÿ­ëÿÿ­ëÿÿ­ëÿÿ­ëÿÿ­ëÿÿ­ëÿÿ­ëÿÿ­ëÿÿ­ëÿÿ­ëÿÿ­ëÿÿ­ëÿÿ­ëÿÿeëÿÿ­ëÿÿAëÿÿñ=ù?Ù?¹?™?y?Y?((((( AAAAAABBBBBB §KÞ Ñ"á$'a)Ô+m.-14-7r:é=”AwE”IñMRsW¢\bïgnžt‡{Ù‚™ŠÐ’ƒ›º¤|®Ó¸ÇÃ`Ϫۮèxö–0w,aîºQ ™Ämôjp5¥c飕dž2ˆÛ¤¸ÜyéÕàˆÙÒ—+L¶ ½|±~-¸ç‘¿d·ò °jHq¹óÞA¾„}ÔÚëäÝmQµÔôÇ…ÓƒV˜lÀ¨kdzùbýìÉeŠO\Ùlcc=úõ È n;^iLäA`Õrqg¢Ñäjm ¨Zjz Ïäÿ “'® ±ž}D“ðÒ£‡hòþÂi]Wb÷Ëge€q6lçknvÔþà+Ó‰ZzÚÌJÝgoß¹ùùﾎC¾·ÕŽ°`è£ÖÖ~“Ñ¡ÄÂØ8RòßOñg»ÑgW¼¦Ýµ?K6²HÚ+ ØL ¯öJ6`zAÃï`ßUßg¨ïŽn1y¾iFŒ³a˃f¼ Òo%6âhR•w ÌG »¹"/&U¾;ºÅ( ½²’Z´+j³\§ÿ×Â1Ïе‹žÙ,®Þ[°Âd›&òc윣ju “m© œ?6ë…grW‚J¿•z¸â®+±{8¶ ›ŽÒ’ ¾Õå·ïÜ|!ßÛ ÔÒÓ†BâÔñø³ÝhnƒÚ;[&¹öáw°owG·æZˆpjÿÊ;f\ ÿžei®bøÓÿkaEÏlxâ  îÒ ×TƒN³9a&g§÷`ÐMGiIÛwn>JjÑ®ÜZÖÙf ß@ð;Ø7S®¼©Åž»ÞϲGéÿµ0ò½½ŠÂºÊ0“³S¦£´$6к“×Í)WÞT¿gÙ#.zf³¸JaÄh]”+o*7¾ ´¡Ž ÃßZï-‰#›2$F­W6e¿tHŒÁZ¯Ó¾lÊåÛ~é÷ø“3"¥V,G·u>dÉœ@Û¿R®íÚdËÿùvè!‹0™&g¯v4D½UJ­Ã¼XŽÑŸnëçú|ÈõÙƒ1 ‘§w.fµTá·ð@ÉR+Û:dNí_vmÿ|‰”…›·¦­Ò$ÿñ6àÁH Ó;Z*å^lO÷}~l ¥ƒ´†‘—.ã§ò<ÀµÑB)Ë8P Ùfoï~tLý]‹µ¤™–‡¯ó&â½Ð4ÁÃ9J(ÑX çnnõ\|M Æ…×å—ô(€¡‘:£³²DJÍ[Vißx` ér/û>ÖÇŸõä© »³2¢ÅZLK×y^háh ó?z.ç‡öÄ•Õ*¡£°8‚±“FkÏzTHÝYb-ëè¦Q:̓tÁ6xä]ª‹|2Å®Yà*Ý“dø¶A`—Ù.E²ü ¾Ið›l"ÕôMºÑ&hŸ‘‘ýýýýýýýýýíý}ýýýýýýíAFGHANISTANAFALBANIAALALGERIADZAMERICAN SAMOAASANDORRAADANGOLAAOANGUILLAAIANTARCTICAAQANTIGUA AND BARBUDAAGARGENTINAARARMENIAAMARUBAAWASCENSION ISLANDACASHMORE AND CARTIER ISLANDSZ1AUSTRALIAAUAUSTRIAATAZERBAIJANAZBAHAMASBSBAHRAINBHBAKER ISLANDZ2BANGLADESHBDBARBADOSBBBELARUSBYBELGIUMBEBELIZEBZBENINBJBERMUDABMBHUTANBTBOLIVIABOBOSNIA AND HERZEGOVINABABOTSWANABWBOUVET ISLANDBVBRAZILBRBRITISH INDIAN OCEAN TERRITORYIOBRUNEI DARUSSALAMBNBULGARIABGBURKINA FASOBFBURUNDIBICAMBODIAKHCAMEROONCMCANADACACAPE VERDECVCAYMAN ISLANDSKYCENTRAL AFRICAN REPUBLICCFCHADTDCHANNEL ISLANDSCHILECLCHINACNCHRISTMAS ISLANDCXCLIPPERTON ISLANDCPCOCOS (KEELING) ISLANDSCCCOLOMBIACOCOMOROSKMCONGOCGCONGO, THE DEMOCRATIC REPUBLIC OF THECDCOOK ISLANDSCKCORAL SEA ISLANDSCOSTA RICACRCOTE D'IVOIRECICROATIAHRCUBACUCYPRUSCYCZECH REPUBLICCZDENMARKDKDIEGO GARCIADJIBOUTIDJDOMINICADMDOMINICAN REPUBLICDOECUADORECEGYPTEGEL SALVADORSVEQUATORIAL GUINEAGQERITREAERESTONIAEEETHIOPIAETFALKLAND ISLANDS (MALVINAS)FKFAROE ISLANDSFOFIJIFJFINLANDFIFRANCEFRFRENCH GUIANAGFFRENCH POLYNESIAPFFRENCH SOUTHERN TERRITORIESTFGABONGAGAMBIAGMGEORGIAGEGERMANYDEGHANAGHGIBRALTARGIGREECEGRGREENLANDGLGRENADAGDGUADELOUPEGPGUAMGUGUANTANAMO BAYGUATEMALAGTGUERNSEYGGGUINEAGNGUINEA-BISSAUGWGUYANAGYHAITIHTHEARD ISLAND AND MCDONALD ISLANDSHMHOLY SEE (VATICAN CITY STATE)VAHONDURASHNHONG KONGHKHOWLAND ISLANDHUNGARYHUICELANDISINDIAININDONESIAIDIRAN, ISLAMIC REPUBLIC OFIRIRAQIQIRELANDIEISRAELILITALYITJAMAICAJMJAN MAYENJAPANJPJAPAN_1J1JAPAN_2J2JAPAN_3J3JAPAN_4J4JAPAN_5J5JAPAN_6J6JAPAN_7J7JAPAN_8J8JARVIS ISLANDJERSEYJEJOHNSTON ATOLLJORDANJOKAZAKHSTANKZKENYAKEKINGMAN REEFKIRIBATIKIKOREA, DEMOCRATIC PEOPLE'S REPUBLIC OFKPKOREA, REPUBLIC OFKRKUWAITKWKYRGYZSTANKGLAO PEOPLE'S DEMOCRATIC REPUBLICLALATVIALVLEBANONLBLESOTHOLSLIBERIALRLIBYAN ARAB JAMAHIRIYALYLIECHTENSTEINLILITHUANIALTLUXEMBOURGLUMACAOMOMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OFMKMADAGASCARMGMALAWIMWMALAYSIAMYMALDIVESMVMALIMLMALTAMTMAN, ISLE OFIMMARSHALL ISLANDSMHMARTINIQUEMQMAURITANIAMRMAURITIUSMUMAYOTTEYTMEXICOMXMICRONESIA, FEDERATED STATES OFFMMIDWAY ISLANDSMOLDOVA, REPUBLIC OFMDMONACOMCMONGOLIAMNMONTSERRATMSMOROCCOMAMOZAMBIQUEMZMYANMARMMNAMIBIANANAURUNRNEPALNPNETHERLANDSNLNETHERLANDS ANTILLESANNEW CALEDONIANCNEW ZEALANDNZNICARAGUANINIGERNENIGERIANGNIUENUNORFOLK ISLANDNFNORTHERN MARIANA ISLANDSMPNORWAYNOOMANOMPAKISTANPKPALAUPWPALESTINIAN TERRITORY, OCCUPIEDPSPALMYRA ATOLLPANAMAPAPAPUA NEW GUINEAPGPARAGUAYPYPERUPEPHILIPPINESPHPITCAIRNPNPOLANDPLPORTUGALPTPUERTO RICOPRQATARQAREUNIONREROMANIAROROTA ISLANDRUSSIAN FEDERATIONRURWANDARWSAIPANSAINT HELENASHSAINT KITTS AND NEVISKNSAINT LUCIALCSAINT PIERRE AND MIQUELONPMSAINT VINCENT AND THE GRENADINESVCSAMOAWSSAN MARINOSMSAO TOME AND PRINCIPESTSAUDI ARABIASASENEGALSNSEYCHELLESSCSIERRA LEONESLSINGAPORESGSLOVAKIASKSLOVENIASISOLOMON ISLANDSSBSOMALIASOSOUTH AFRICAZASOUTH GEORGIA AND THE SOUTH SANDWICH ISLANDSGSSPAINESSRI LANKALKSUDANSDSURINAMESRSVALBARD AND JAN MAYENSJSWAZILANDSZSWEDENSESWITZERLANDCHSYRIAN ARAB REPUBLICSYTAIWAN, PROVINCE OF CHINATWTAJIKISTANTJTANZANIA, UNITED REPUBLIC OFTZTHAILANDTHTIMOR-LESTE (EAST TIMOR)TLTINIAN ISLANDTOGOTGTOKELAUTKTONGATOTRINIDAD AND TOBAGOTTTRISTAN DA CUNHATATUNISIATNTURKEYTRTURKMENISTANTMTURKS AND CAICOS ISLANDSTCTUVALUTVUGANDAUGUKRAINEUAUNITED ARAB EMIRATESAEUNITED KINGDOMGBUNITED STATESUSUNITED STATES MINOR OUTLYING ISLANDSUMURUGUAYUYUZBEKISTANUZVANUATUVUVENEZUELAVEVIET NAMVNVIRGIN ISLANDS, BRITISHVGVIRGIN ISLANDS, U.S.VIWAKE ISLANDWALLIS AND FUTUNAWFWESTERN SAHARAEHYEMENYEYUGOSLAVIAYUZAMBIAZMZIMBABWEZWRADAR CHANNELSRDRALL CHANNELSALLvarunrecognized name, type -h for helpverget version informationcmdsgenerate a short list of available commandsupreinitialize and mark adapter up (operational)downreset and mark adapter down (disabled)outmark adapter down but do not reset hardware(disabled) On dualband cards, cards must be bandlocked before use.clkset board clock state. return error for set_clk attempt if the driver is not down 0: clock off 1: clock onrestartRestart driver. Driver must already be down.rebootReboot platformradioSet the radio on or off. "on" or "off"dumpGive suboption "list" to list various suboptionssrclearClearthe sromsrdumpprint contents of SPROM to stdoutsrwriteWrite the sromnvram_dumpprint nvram variables to stdoutnvsetset an nvram variable name=value (no spaces around '=')nvgetget the value of an nvram variablenvram_getrevinfoget hardware revision informationmsglevelset driver console debugging message bitvector type 'wl msglevel ?' for valuesset driver power management mode: 0: CAM (constantly awake) 1: PS (power-save) 2: FAST PS modewakeset driver power-save mode sleep state: 0: core-managed 1: awakepromiscset promiscuous mode ethernet address reception 0 - disable 1 - enablemonitorset monitor mode 0 - disable 1 - enable active monitor mode (interface still operates)fragDeprecated. Use fragthresh.rtsDeprecated. Use rtsthresh.cwminSet the cwmin. (integer [1, 255])cwmaxSet the cwmax. (integer [256, 2047])srlSet the short retry limit. (integer [1, 255])lrlSet the long retry limit. (integer [1, 255])rateforce a fixed rate: valid values for 802.11a are (6, 9, 12, 18, 24, 36, 48, 54) valid values for 802.11b are (1, 2, 5.5, 11) valid values for 802.11g are (1, 2, 5.5, 6, 9, 11, 12, 18, 24, 36, 48, 54) -1 (default) means automatically determine the best ratemrateforce a fixed multicast rate: valid values for 802.11a are (6, 9, 12, 18, 24, 36, 48, 54) valid values for 802.11b are (1, 2, 5.5, 11) valid values for 802.11g are (1, 2, 5.5, 6, 9, 11, 12, 18, 24, 36, 48, 54) -1 (default) means automatically determine the best ratea_rateforce a fixed rate for the A PHY: valid values for 802.11a are (6, 9, 12, 18, 24, 36, 48, 54) -1 (default) means automatically determine the best ratea_mrateforce a fixed multicast rate for the A PHY: valid values for 802.11a are (6, 9, 12, 18, 24, 36, 48, 54) -1 (default) means automatically determine the best ratebg_rateforce a fixed rate for the B/G PHY: valid values for 802.11b are (1, 2, 5.5, 11) valid values for 802.11g are (1, 2, 5.5, 6, 9, 11, 12, 18, 24, 36, 48, 54) -1 (default) means automatically determine the best ratebg_mrateforce a fixed multicast rate for the B/G PHY: valid values for 802.11b are (1, 2, 5.5, 11) valid values for 802.11g are (1, 2, 5.5, 6, 9, 11, 12, 18, 24, 36, 48, 54) -1 (default) means automatically determine the best rateinfraSet Infrastructure mode: 0 (IBSS) or 1 (Infra BSS)apSet AP mode: 0 (STA) or 1 (AP)bssidGet the BSSID value, error if STA and not associatedbssmaxget number of BSSes channelSet the channel: valid channels for 802.11b/g (2.4GHz band) are 1 through 14 valid channels for 802.11a (5 GHz band) are: 36, 40, 44, 48, 52, 56, 60, 64, 100, 104, 108, 112, 116,120, 124, 128, 132, 136, 140, 149, 153, 157, 161, 184, 188, 192, 196, 200, 204, 208, 212, 216cur_mcssetGet the current mcs setchanspecsGet all the valid chanspecs (default: all within current locale): -b band (5(a) or 2(b/g)) -w bandwidth, 10,20 or 40 [-c country_abbrev] chanspecSet [a,b][n][u,l] channel number (0-224) band a=5G, b=2G, default to 2G if channel <= 14 bandwidth, n=10, non for 20 & 40 ctl sideband, l=lower, u=upper OR Set channel with legacy format: -c channel number (0-224) -b band (5(a) or 2(b/g)) -w bandwidth, 10,20 or 40 -s ctl sideband, -1=lower, 0=none, 1=upperdfs_channel_forcedSet [a,b][n][u,l] channel number (0-224) band a=5G, b=2G, default to 2G if channel <= 14 bandwidth, n=10, non for 20 & 40 ctl sideband, l=lower, u=upper tssiGet the tssi value from radiotxpwrSet tx power in milliwatts. Range [1, 84].txpwr1Set tx power in in various units. Choose one of (default: dbm): -d dbm units -q quarter dbm units -m milliwatt units Can be combined with: -o turn on override to disable regulatory and other limitations Use wl txpwr -1 to restore defaultstxpathpwrTurn the tx path power on or off on 2050 radiostxpwrlimitReturn current tx power limitpowerindexSet the transmit power for A band(0-63). -1 - default valueattenSet the transmit attenuation for B band. Args: bb radio txctl1. auto to revert to automatic control manual to supspend automatic controlphyregGet/Set a phy register: offset [ value ] [ band ]radioregGet/Set a radio register: offset [ value ] [ band ]ucflagsGet/Set ucode flags 1, 2, 3(16 bits each) offset [ value ] [ band ]shmemGet/Set a shared memory location: offset [ value ] [band ]macregGet/Set any mac registers(include IHR and SB): macreg offset size[2,4] [ value ] [ band ]ucantdivEnable/disable ucode antenna diversity (1/0 or on/off)gpiooutSet any GPIO pins to any value. Use with caution as GPIOs would be assigned to chipcommon Usage: gpiomask gpiovalampdu_tidenable/disable per-tid ampdu; usage: wl ampdu_tid [0/1]ampdu_send_addbasend addba to specified ea-tid; usage: wl ampdu_send_addba ampdu_send_delbasend delba to specified ea-tid; usage: wl ampdu_send_delba ampdu_clear_dumpclear ampdu countersdpt_denyadds/removes ea to dpt deny list usage: wl dpt_deny dpt_endpointcreates/updates/deletes dpt endpoint for ea usage: wl dpt_endpoint antdivSet antenna diversity for rx 0 - force use of antenna 0 1 - force use of antenna 1 3 - automatic selection of antenna diversitytxantSet the transmit antenna 0 - force use of antenna 0 1 - force use of antenna 1 3 - use the RX antenna selection that was in force during the most recently received good PLCP headerplcphdrSet the plcp header. "long" or "auto" or "debug"phytypeGet phy typerateparamset driver rate selection tunables arg 1: tunable id arg 2: tunable valuewepstatusSet or Get WEP status wepstatus [on|off]primary_keySet or get index of primary keyaddwepSet an encryption key. The key must be 5, 13 or 16 bytes long, or 10, 26, 32, or 64 hex digits long. The encryption algorithm is automatically selected based on the key size. keytype is accepted only when key length is 16 bytes/32 hex digits and specifies whether AES-OCB or AES-CCM encryption is used. Default is ccm. addwep [ocb | ccm] [notx] [xx:xx:xx:xx:xx:xx]rmwepRemove the encryption key at the specified key index.keysPrints a list of the current WEP keystscPrint Tx Sequence Couter for key at specified key index.wsec_testGenerate wsec errors wsec_test type 'wl wsec_test ?' for test_typestkip_countermeasuresEnable or disable TKIP countermeasures (TKIP-enabled AP only) 0 - disable 1 - enablewsec_restrictDrop unencrypted packets if WSEC is enabled 0 - disable 1 - enableeaprestrict traffic to 802.1X packets until 802.1X authorization succeeds 0 - disable 1 - enablecur_etheraddrGet/set the current hw addressauthorizerestrict traffic to 802.1X packets until 802.1X authorization succeedsdeauthorizedo not restrict traffic to 802.1X packets until 802.1X authorization succeedsdeauthenticatedeauthenticate a STA from the AP with optional reason code (AP ONLY)wsecwireless security bit vector 1 - WEP enabled 2 - TKIP enabled 4 - AES enabled 8 - WSEC in software 0x80 - FIPS enabledauthset/get 802.11 authentication type. 0 = OpenSystem, 1= SharedKeywpa_authBitvector of WPA authorization modes: 1 WPA-NONE 2 WPA-802.1X/WPA-Professional 4 WPA-PSK/WPA-Personal 0 disable WPAwpa_capset/get 802.11i RSN capabilitiesset_pmkSet passphrase for PMK in driver-resident supplicant.scanInitiate a scan. Default an active scan across all channels for any SSID. Optional arg: SSID, the SSID to scan. Options: -s S, --ssid=S SSID to scan -t ST, --scan_type=ST [active|passive] scan type --bss_type=BT [bss/infra|ibss/adhoc] bss type to scan -b MAC, --bssid=MAC particular BSSID MAC address to scan, xx:xx:xx:xx:xx:xx -n N, --nprobes=N number of probes per scanned channel -a N, --active=N dwell time per channel for active scanning -p N, --passive=N dwell time per channel for passive scanning -h N, --home=N dwell time for the home channel between channel scans -c L, --channels=L comma or space separated list of channels to scaniscan_sInitiate an incremental scan. Default an active scan across all channels for any SSID. Optional arg: SSID, the SSID to scan. Options: -s S, --ssid=S SSID to scan -t ST, --scan_type=ST [active|passive] scan type --bss_type=BT [bss/infra|ibss/adhoc] bss type to scan -b MAC, --bssid=MAC particular BSSID MAC address to scan, xx:xx:xx:xx:xx:xx -n N, --nprobes=N number of probes per scanned channel -a N, --active=N dwell time per channel for active scanning -p N, --passive=N dwell time per channel for passive scanning -h N, --home=N dwell time for the home channel between channel scans -c L, --channels=L comma or space separated list of channels to scaniscan_cContinue an incremental scan. Default an active scan across all channels for any SSID. Optional arg: SSID, the SSID to scan. Options: -s S, --ssid=S SSID to scan -t ST, --scan_type=ST [active|passive] scan type --bss_type=BT [bss/infra|ibss/adhoc] bss type to scan -b MAC, --bssid=MAC particular BSSID MAC address to scan, xx:xx:xx:xx:xx:xx -n N, --nprobes=N number of probes per scanned channel -a N, --active=N dwell time per channel for active scanning -p N, --passive=N dwell time per channel for passive scanning -h N, --home=N dwell time for the home channel between channel scans -c L, --channels=L comma or space separated list of channels to scanpassivePuts scan engine into passive moderegulatoryGet/Set regulatory domain mode (802.11d). Driver must be down.spectGet/Set 802.11h Spectrum Management mode. 0 - Off 1 - Loose interpretation of 11h spec - may join non-11h APs 2 - Strict interpretation of 11h spec - may not join non-11h APs 3 - Disable 11h and enable 11d 4 - Loose interpretation of 11h+d spec - may join non-11h APsscanresultsReturn results from last scan.iscanresultsReturn results from last iscan. Specify a buflen (max 8188) to artificially limit the size of the results buffer. iscanresults [buflen] assocPrint information about current network association. (also known as "status")statusPrint information about current network association. (also known as "assoc")disassocDisassociate from the current BSS/IBSS.chanlistDeprecated. Use channels.channelsReturn valid channels for the current settings.channels_in_countryReturn valid channels for the country specified. Arg 1 is the country abbreviation Arg 2 is the band(a or b)curpowerReturn current tx power settings. -q (quiet): estimated power only.txinstpwrReturn tx power based on instant TSSI scansuppressSuppress all scans for testing. 0 - allow scans 1 - suppress scansevmStart an EVM test on the given channel, or stop EVM test. Arg 1 is channel number 1-14, or "off" or 0 to stop the test. Arg 2 is optional rate (1, 2, 5.5 or 11)ratesetReturns or sets the supported and basic rateset, (b) indicates basic With no args, returns the rateset. Args are rateset "default" | "all" | default - driver defaults all - all rates are basic rates arbitrary rateset - list of rates List of rates are in Mbps and each rate is optionally followed by "(b)" or "b" for a Basic rate. Example: 1(b) 2b 5.5 11 At least one rate must be Basic for a legal rateset.roam_triggerGet or Set the roam trigger RSSI threshold: Get: roam_trigger [a|b] Set: roam_trigger [a|b|all] integer - 0: default 1: optimize bandwidth 2: optimize distance [-1, -99]: dBm trigger valueroam_deltaSet the roam candidate qualification delta. roam_delta [integer [, a/b]]roam_scan_periodSet the roam candidate qualification delta. (integer)supratesReturns or sets the 11g override for the supported rateset With no args, returns the rateset. Args are a list of rates, or 0 or -1 to specify an empty rateset to clear the override. List of rates are in Mbps, example: 1 2 5.5 11scan_channel_timeGet/Set scan channel timescan_unassoc_timeGet/Set unassociated scan channel dwell timescan_home_timeGet/Set scan home channel dwell timescan_passive_timeGet/Set passive scan channel dwell timescan_nprobesGet/Set scan parameter for number of probes to use per channel scannedprb_resp_timeoutGet/Set probe response timeoutchannel_qaGet last channel quality measurmentchannel_qa_startStart a channel quality measurmentcountrySelect Country Code for driver operational region Use either long name or abbreviation from ISO 3166. Use 'wl country list [band(a or b)]' for the list of supported countriesautocountry_defaultSelect Country Code for use with Auto Contry DiscoveryjoinJoin a specified network SSID. Join syntax is: join [key xxxxx] [imode bss|ibss] [amode open|shared|wpa|wpapsk|wpa2|wpa2psk|wpanone]ssidSet or get a configuration's SSID. wl ssid [-C num]|[--cfg=num] [] If the configuration index 'num' is not given, configuraion #0 is assumed and setting will initiate an assoication attempt if in infrastructure mode, or join/creation of an IBSS if in IBSS mode, or creation of a BSS if in AP mode.macSet or get the list of source MAC address matches. wl mac xx:xx:xx:xx:xx:xx [xx:xx:xx:xx:xx:xx ...] To Clear the list: wl mac nonemacmodeSet the mode of the MAC list. 0 - Disable MAC address matching. 1 - Deny association to stations on the MAC list. 2 - Allow association to stations on the MAC list.wdsSet or get the list of WDS member MAC addresses. Set using a space separated list of MAC addresses. wl wds xx:xx:xx:xx:xx:xx [xx:xx:xx:xx:xx:xx ...]lazywdsSet or get "lazy" WDS mode (dynamically grant WDS membership to anyone).noiseGet noise (moving average) right after tx in dBmfqacurcyManufacturing test: set frequency accuracy mode. freqacuracy syntax is: fqacurcy Arg is channel number 1-14, or 0 to stop the test.crsuprsManufacturing test: set carrier suppression mode. carriersuprs syntax is: crsuprs Arg is channel number 1-14, or 0 to stop the test.longtrainManufacturing test: set longtraining mode. longtrain syntax is: longtrain Arg is A band channel number or 0 to stop the test.bandReturns or sets the current band auto - auto switch between available bands (default) a - force use of 802.11a band b - force use of 802.11b bandbandsReturn the list of available 802.11 bandsphylistReturn the list of available phytypesshortslotGet current 11g Short Slot Timing mode. (0=long, 1=short)shortslot_overrideGet/Set 11g Short Slot Timing mode override. (-1=auto, 0=long, 1=short)shortslot_restrictGet/Set AP Restriction on associations for 11g Short Slot Timing capable STAs. 0 - Do not restrict association based on ShortSlot capability 1 - Restrict association to STAs with ShortSlot capabilityignore_bcnsAP only (G mode): Check for beacons without NONERP element(0=Examine beacons, 1=Ignore beacons)pktcntGet the summary of good and bad packets.upgradeUpgrade the firmware on an embedded devicegmodeSet the 54g Mode (LegacyB|Auto||GOnly|BDeferred|Performance|LRS)gmode_protectionGet G protection mode. (0=disabled, 1=enabled)gmode_protection_controlGet/Set 11g protection mode control alg.(0=always off, 1=monitor local association, 2=monitor overlapping BSS)gmode_protection_overrideGet/Set 11g protection mode override. (-1=auto, 0=disable, 1=enable)protection_controlGet/Set protection mode control alg.(0=always off, 1=monitor local association, 2=monitor overlapping BSS)legacy_erpGet/Set 11g legacy ERP inclusion (0=disable, 1=enable)scb_timeoutAP only: inactivity timeout value for authenticated stasassoclistAP only: Get the list of associated MAC addresses.isupGet driver operational state (0=down, 1=up)rssiGet the current RSSI val, for an AP you must specify the mac addr of the STAphy_rssi_antGet RSSI per antenna (only support NPHY now) fasttimerDeprecated. Use fast_timer.slowtimerDeprecated. Use slow_timer.glacialtimerDeprecated. Use glacial_timer.radarEnable/Disable radarradarargsGet/Set Radar parameters in order as npulses, ncontig, min_pw , max_pw, thresh0, thresh1, blank, fmdemodcfg, tnpulses_lp, min_pw_lp, max_pw_lp, min_fm_lp, max_deltat_lp, min_deltat, max_deltat radarargs40Get/Set Radar parameters for 40Mhz channel in order as npulses, ncontig, min_pw , max_pw, thresh0, thresh1, blank, fmdemodcfg, tnpulses_lp, min_pw_lp, max_pw_lp, min_fm_lp, max_deltat_lp, min_deltat, max_deltat dfs_statusGet dfs statusinterferenceGet/Set interference mitigation mode. Choices are: 0 = none 1 = non wlan 2 = wlan manual 3 = wlan automaticframeburstDisable/Enable frameburst modepwr_percentGet/Set power output percentagetoeEnable/Disable tcpip offload featuretoe_olGet/Set tcpip offload componentstoe_statsDisplay checksum offload statisticstoe_stats_clearClear checksum offload statisticsarpoeEnable/Disable arp agent offload featurearp_olGet/Set arp offload componentsarp_peerageGet/Set age of the arp entry in minutesarp_table_clearClear arp cachearp_hostipAdd a host-ip address or display themarp_hostip_clearClear all host-ip addressesarp_statsDisplay ARP offload statisticsarp_stats_clearClear ARP offload statisticswetGet/Set wireless ethernet bridging modebiGet/Set the beacon period (bi=beacon interval)dtimGet/Set DTIMwds_remote_macGet WDS link remote endpoint's MAC addresswds_wpa_role_oldGet WDS link local endpoint's WPA role (old)wds_wpa_roleGet/Set WDS link local endpoint's WPA roleauthe_sta_listGet authenticated sta mac address listautho_sta_listGet authorized sta mac address listmeasure_reqSend an 802.11h measurement request. Usage: wl measure_req Measurement types are: TPC, Basic, CCA, RPI Target MAC addr format is xx:xx:xx:xx:xx:xxquietSend an 802.11h quiet command. Usage: wl quiet , , csaSend an 802.11h channel switch anouncement with chanspec: [a,b][n][u,l] mode (0 or 1) count (0-254) channel number (0-224) band a=5G, b=2G bandwidth n=10, non for 20 & 40 ctl sideband, l=lower, u=upper, default no ctl sideband constraintSend an 802.11h Power Constraint IE Usage: wl constraint 1-255 dbrm_reqRequest a radio measurement of type basic, cca, or rpi specify a series of measurement types each followed by options. example: wl rm_req cca -c 1 -d 50 cca -c 6 cca -c 11 Options: -t n numeric token id for measurement set or measurement -c n channel -d n duration in TUs (1024 us) -p parallel flag, measurement starts at the same time as previous Each measurement specified uses the same channel and duration as the previous unless a new channel or duration is specified.rm_repGet current radio measurement reportjoin_prefSet/Get join target preferences.assoc_prefSet/Get association preference. Usage: wl assoc_pref [auto|a|b|g]wmeSet WME (Wireless Multimedia Extensions) mode (0=off, 1=on, -1=auto)wme_acwl wme_ac ap|sta [be|bk|vi|vo [ecwmax|ecwmin|txop|aifsn|acm ] ...]wme_apsdSet APSD (Automatic Power Save Delivery) mode on AP (0=off, 1=on)wme_apsd_staSet APSD parameters on STA. Driver must be down. Usage: wl wme_apsd_sta : number of frames per USP: 0 (all), 2, 4, or 6 : value 0 to disable, 1 to enable U-APSD per ACwme_dpSet AC queue discard policy. Usage: wl wme_dp : value 0 for newest-first, 1 for oldest-firstwme_countersprint WMM statswme_clear_countersclear WMM counterslifetimeSet Lifetime parameter (milliseconds) for each ac. wl lifetime be|bk|vi|vo []reinitReinitialize devicesta_infowl sta_info nphy_test_tssiwl nphy_test_tssi valnphy_test_tssi_offswl nphy_test_tssi_offs valnphy_rssiantwl nphy_rssiant antindex(0-3)capdriver capabilitiesmalloc_dumpDeprecated. Folded under 'wl dump mallocchan_infochannel infoadd_ieAdd a vendor proprietary IE to 802.11 management packets Usage: wl add_ie length OUI hexdata : Bit 0 - Beacons Bit 1 - Probe Rsp Bit 2 - Assoc/Reassoc Rsp Bit 3 - Auth Rsp Bit 4 - Probe Req Bit 5 - Assoc/Reassoc Req Example: wl add_ie 3 10 00:90:4C 0101050c121a03 to add this IE to beacons and probe responsesdel_ieDelete a vendor proprietary IE from 802.11 management packets Usage: wl del_ie length OUI hexdata : Bit 0 - Beacons Bit 1 - Probe Rsp Bit 2 - Assoc/Reassoc Rsp Bit 3 - Auth Rsp Bit 4 - Probe Req Bit 5 - Assoc/Reassoc Req Example: wl del_ie 3 10 00:90:4C 0101050c121a03list_ieDump the list of vendor proprietary IEsrandGet a 2-byte Random Number from the MAC's PRNG Usage: wl randotpwWrite an srom image to on-chip otp Usage: wl otpw filenvotpwWrite nvram to on-chip otp Usage: wl nvotpw filebcmerrorstrerrorstringfreqtrackSet Frequency Tracking Mode (0=Auto, 1=On, 2=OFF)eventingset/get 128-bit hex filter bitmask for MAC event reporting up to application layerevent_msgsset/get 128-bit hex filter bitmask for MAC event reporting via packet indicationscountersReturn driver counter valuesassoc_infoReturns the assoc req and resp information [STA only]autochannelauto channel selection: 1 to issue a channel scanning; 2 to set channel based on the channel scanning result; without argument to only show the channel selected; ssid must set to null before this process, RF must be upcsscantimerauto channel scan timer in minutes (0 to disable)closedhides the network from active scans, 0 or 1. 0 is open, 1 is hideabminrateget/set afterburner minimum rate thresholdbssset/get BSS enabled status: up/downclosednetset/get BSS closed network attributeap_isolateset/get AP isolationeap_restrictset/get EAP restrictiondiagdiag testindex(1-interrupt, 2-loopback, 3-memory, 4-led); precede by 'wl down' and follow by 'wl up'reset_d11cntsreset 802.11 MIB countersstanameget/set station name: Maximum name length is 15 bytesapnameget AP nameotpdumpDump raw otpnrate-r legacy rate (CCK, OFDM)-m mcs index-s stf mode (0=SISO,1=CDD,2=STBC(not supported),3=SDM)mimo_txbwget/set mimo txbw (2=20Mhz(lower), 3=20Mhz upper, 4=40Mhz, 5=40Mhz dup[AUTO] [AUTO] [AUTO] [AUTO] where utx = TX unicast antenna configuration urx = RX unicast antenna configuration dtx = TX default (non-unicast) antenna configuration drx = RX default (non-unicast) antenna configuration txfifo_szset/get the txfifo size; usage: wl txfifo_sz phy_rxiqestGet phy RX IQ noise in dBm: -s # of samples (2^n) -a antenna select, 0,1 or 3 rifsset/get the rifs status; usage: wl rifs <1/0> (On/Off) pkteng_startrun packet engine; usage: wl pkteng [ipg] [len] [nframes] ipg: inter packet gap in us len: packet length nframes: number of frames; 0 indicates continuous tx test pkteng_stopstop packet engine; usage: wl pkteng_stopwowlEnable/disable WOWL events 0 - Clear all events Bit 0 - Wakeup on Magic Packet Bit 1 - Wakeup on NetPattern (use 'wl wowl_pattern' to configure pattern) Bit 2 - Wakeup on loss-of-link due to Disassociation/Deauth Bit 3 - Wakeup on retrograde tsf (use 'wl wowl_tsf_retr' to configure time) Bit 4 - Wakeup on loss of beacon (use 'wl wowl_bcn_loss' to configure time) wowl_tsf_retrSet #of seconds of TSF retrogression for wakeup event (use 'wl wowl' to configure the event) wowl_bcn_lossSet #of seconds of beacon loss for wakeup event (use 'wl wowl' to configure the event) wowl_patternusage: wowl_pattern [ [ add | del ] offset mask value ] No options -- lists existing pattern list add -- Adds the pattern to the list del -- Removes a pattern from the list offset -- Starting offset for the pattern mask -- Mask to be used for pattern. Bit i of mask corresponds to byte i of the pattern value -- Value of the pattern agentsnoophost_auto_replypeer_auto_replytx_csum_olrx_csum_olmic_errorreplayerrorerrtraceprhdrsprpktinforminfoinftmpoidasprusrpspwrdualwsec_dumplognrssiloftphycalmpcapstadfsbambsscacamsduampduffpld-a-i-derror: expected interface name after option %s -u-x-h%s %s %s %s Failed to allocate buffer of %d bytes Usage: %s [-a|i ] [-h] [-d|u|x] [arguments] -h this message and command descriptions -h [cmd] command description for cmd -a, -i adapter name or number -d output format signed integer -u output format unsigned integer -x output format hexdecimal Version mismatch, please upgrade %u 0x%x %d onofflegacyautogonlyunknown%s (%d) perflrs54g LRS54g Performance54g Only54g Auto54g Legacy Bab0x%04x %s is 0x%04x(%d) allband option "all" is for set only, not get0x%04x srom[%03d]: Writing srom. ioctl %d, iolen %d, sroff %d, len %d rbData extends past 440 bytes error %d reading %s srclear takes only one arg Error %d writing the srom File %s is %d bytes, not 128 or 440 bytes %s is not an integer File %s is 440 bytes but lacks a REV4 signature Byte offset (%d) is odd or negative File %s is too large %s: No such file or directory msg values may be a list of numbers or names from the following set. Use a + or - prefix to make an incremental change. 0x%04x %s, %s0x%x %s-15.5%d Kbps.5%d%s Mbps%02Xrssi[%d] %d not supported on this chipmbss16mbss4Assoc req: len 0x%x Assoc resp: capab 0x%x status 0x%x aid 0x%x listen 0x%x assoc_req_iesassoc req IEs: 0x%02x reassoc bssid %s assoc_resp_iesassoc resp IEs: 0x%02x [ (b)%d%s%s unable to convert trailing characters "%s" in the rate parameter "%s" parsing "%s", too many rates specified, max is %d rates unable to convert the rate parameter "%s" 0Warning: Basic rate attribute ignored for "%s" command defaultBad Args: at least one rate must be marked Basic --%s: missing value after " = " in long param "%s" %s: only single char options, error on param "%s" %s: missing " = " in long param "%s" %s: missing value parameter after "%s" cfgconfigconfiguration%s: could not parse "%s" as an integer for the configuartion index Scan in progress.No scan in progress.current mac channel %d target channel %d current scan channel %d %u.%u.%u.%u\x%02X%02x %04d: longdebugscan_typeactivebss_typenprobeshome ,error parsing channel list arg ibssadhocanywl_scan: missing value after " = " in long param "%s" could not parse channel number starting at substring "%s" in list: %s too many channels (more than %d) in channel list: %s SSID arg "%s" must be 32 chars or less could not parse "%s" as an int for home channel dwell time could not parse "%s" as an int for value nprobes could not parse "%s" as an int for passive dwell time could not parse "%s" as an int for active dwell time could not parse "%s" as an ethternet MAC address scan_type value should be "active" or "passive", but got "%s" wl_scan: missing " = " in long param "%s" wl_scan: only single char options, error on param "%s" wl_scan: missing value parameter after "%s" bss_type value should be "bss", "ibss", or "any", but got "%s" Error allocating %d bytes for scan params RSN:RSN No %s Capabilities advertised WPA:WPA multicast cipher: WEP128AES-CCMPAES-OCBTKIPWEP64NONE Capabilities(0x%04x): %sPre-Auth, No %sPairwise, s%d PTK Replay Ctr%s%d GTK Replay Ctr%s AKM Suites(%d): Unknown-%s(#%d) Unknown-%02X:%02X:%02X(#%d) unicast ciphers(%d): WEP128 AES-CCMP AES-OCB TKIP WEP64 NONE WPA-Unknown-%s(#%d) Unknown-%02X:%02X:%02X(#%d) None WPA WPA-PSK Unknown-%s(#%d) ID: 0x%02X Len: %d IE data truncated: ID: 0x%02X Len: %d Data:IE header truncated: ID: 0x%02X Data: SSID: "%s" Mode: %s RSSI: %d dBm noise: %d dBm Channel: %d BSSID: %s Capability: Supported Rates: 802.11N Capable:5 Chanspec: %sGHz channel %d %dMHz (0x%x) Control channel: %d 802.11N Capabilities: Supported MCS : [ %d ]CCK-OFDM ShortSlot Agility PBCC ShortPre WEP PollReq Pollable IBSS ESS ManagedAd Hoc2.440Mhz wl_dump_chanspecs%s: you need to set a band, '-b <5|2>' %s: you need to set a bandwidth, '-w <20|40>' %s (0x%04x) %s: could not parse "%s" as an int for band %s: could not parse "%s" as an int for bandwidth %s: please provide country abbrev %s: invalid bandwidth %d %s: invalid band %d invalid country abbrev: %s missing country abbrev missing band unsupported band: %s Loose interpretation of 11h+d spec - may join non-11h APs802.11d modeStrict interpretation of 11h spec - may not join non 11h AP.Loose interpretation of 11h spec - may join non 11h AP.Offinvalid value 0x%x Not associated. Last associated with Sorry, your driver has bss_info_version %d but this program supports only version %d. STA MAC must be specified Malformed STA MAC parameter passphrase must be between %d and %d characters long XX0xccmocbnotxNo primary key setKey %d is primary wsec_keywsec test_type may be a number or name from the following set:insufficient arguments Key index %d out of range. Should be positive. Key %d TSC: 0x%04x:%08x %s: %2d.%-2d %s: %2d.%-2d CCKOFDMMCS 20MHzMCS 40MHzLast B phy CCK est. power: %2d.%d dBm Last A phy est. power: %2d.%d dBm Last B phy OFDM est. power: %2d.%d dBm Need to specify at least one parameter CCK %d OFDM %d qtxpowerTxPower is %d qdbm, %d.%d dbm, %d mW Override is %s -o-q-m%d mW (%d.%d dBm) tx %s bb/radio/ctl1 %d/%d/%d manual%s %s noneclearProblem parsing MAC address "%s". unrecognized band value %d a b ? %c Programming %s... error reading %s Committing image to flash... Done Successfully downloaded %d bytes *** UPGRADE FAILED! *** (status %ld) rawWriting %d bytes from %s file %s to otp ... nvserial File %s too large File %s has an odd length (%d) Error %d writing %s to otp File %s is not an nvserial file File %s looks like an nvserial file, use nvotpw Receive: good packet %d, bad packet %d, othercast good packet %d Transmit: good packet %d, bad packet %d Non-wireless LAN Interference mitigation is enabled.All interference mitigation is disabled.Wireless LAN Interference mitigation is enabled.Auto Wireless LAN Interference mitigation is enabled and not activelistSupported countries: abbreviation and long name%s %s Parameter "%s" was unrecognized as a country name, and is too long for a max 3 character country abbreviation. No country setSetting country code using abbreviation: "%s" Setting country "%s" failed ! g%s/%s AMPDU for tid %d: %d error: missing addresserror: could not parse MAC address %s addremoveerror: missing mode valueerror: invalid mode stringcreatemodifydeleteerror: missing eanpulses %d ncontig %d min_pw %d max_pw %d thresh0 0x%x thresh1 0x%x blank 0x%x fmdemodcfg0x%x npulses_lp %d min_pw_lp %d max_pw_lp %d min_fm_lp %d max_deltat_lp %d min_deltat %d max_deltat %d IDLEPRE-ISM Channel Availability Check(CAC)In-Service Monitoring(ISM)Channel Switching Announcement(CSA)POST-ISM Channel Availability CheckPRE-ISM Ouf Of Channels(OOC)POST-ISM Out Of Channels(OOC)state %s time elapsed %dms radar channel cleared by dfs channel spec %d channel %d Unknown dfs state %d. Unable to get local endpoint's WPA rolesupplicantLocal endpoing's WPA role: %s authenticatorUnable to get remote endpoint's hwaddrInvalid WPA role %s. %u:authenticator, %u:supplicant, %u:auto Unable to set local endpoint's WPA roleLocal endpoint's WPA role: %s tpcbasicccarpierror: unknown measurement type %s error: missing target addresserror: missing argumentserror: missing counterror: missing channelError: bad parameters "%s" get: error, extra arg "%s" get: missing argumentseirpHWPower Control: %s, %s Current channel: %s BSS channel: %s BSS Local Max: %2d.%-2d dBm BSS Local Constraint: %2d.%-2d dB User Target: %2d.%-2d dBm SROM antgain: 2G: %d.%d dB, 5G: %d.%d dB Regulatory Limits:Board Limits:Power Target:Last est. power: %d.%d Ignoring arguments for %s OnSWCurrent channel: %s User Target: %2d.%-2d dBm Regulatory Local Max: %2d.%-2d dBm Regulatory Local Constraint: %2d.%-2d dB No, channel is ConductedAntgain used in Channel Max: %s Hardware Power Control: HW PWRCTL OnRegulatory Channel Max: %2d.%-2d dBm SROM antgain: 2G: %d.%d dB, 5G: %d.%d dB Min of Reg & Local Limits: CCK: %d.%d OFDM: Last A phy est. power: %2d.%-2d dBm Srom limit A:OFDM: Last A phy target power:Last est. power: %d.%d dBm Last CCK est. power: %d.%d dBm Yes, channel is EIRPHW PWRCTL OffLast B phy CCK est. power: %2d.%-2d dBm Last B phy OFDM est. power: %2d.%-2d dBm Srom limit B/G:Last B phy target power:%3d - %3d: (default)%3d: %-17s Key %d: len %d, data 0xAES OCB MPDUAES OCB MSDUAES CCMWEP1No key present%3d: soft Could not query wsec status. (%.*s)MCS SET : [ %d.%d RC%d.%dVersion query failed with error %d %sbcmerrorDriver reports error %d Failed to allocate dump buffer of %d bytes %s: Error getting the last error %s: %s set: missing argumentsset: error parsing value "%s" as an integer for set of "%s" iscanresults returned unknown status %d iscanresults completewl_get_iscan buflen 0iscanresults incompleteiscanresults pendingiscanresults aborteddump: error on query of dump list dump: error on query of WLC_DUMP wl_nratelegacy rate %d%s Mbps stf mode %d %s %s: could not parse "%s" as a rate value mcs index %d stf mode %d %s fixed%s: cannot use -r and -m %s: could not parse "%s" as an int for mcs %s: could not parse "%s" as an int for stf mode %s: you need to set a legacy or mcs rate wepkeywepkeyimodead-hocmanagedmodeamodeopensharedwpanone%s %s: expected argument after "infra" keyword but command line ended. wpawpapsk%s %s: unrecongnized parameter "%s" after "infra" keyword pwr in mw %d pwr in mw after override adj %d %s (0x%x) wl_chanspecChanspec set to 0x%x %s: you need to set a channel, '-c ' %s: you need to set a ctl sideband, '-s <-1|0|1>' %s: invalid ctl sideband %d %s: could not parse "%s" as an int for ctl sideband %s: invalid channel %d %s: could not parse "%s" as an int for the channel a_%sbg_%s%d (0x%x) Error setting variable %s Error getting variable %s ERROR: no valid ether addr providedgpiocontrol 0x%x gpioout 0x%x gpioouten 0x%x unknown iscan command: %s iscanbsscfg:No key specified Setting SSID "%s" Current SSID: "%s" WPA-NONEWPA-802.1xWPA-PSKdisabled%s is not a valid WPA auth mode DisabledInavlid user argument. Values may be a bitvector or list of names from the set. 0x%04x %snvdump error: extra arg "%s" nvget: missing argumentsnvget error: extra arg "%s" nvset: missing argumentsnvset error: extra arg "%s"; format is name=value (no spaces around '=') nvset error: no '=' in "%s", format is name=value (no spaces around '=') per_chan_infoNot supported in current locale Usage: %s [channel | All ] Invalid ChannelChannel %d A BandB Band, RADAR Sensitive, Restricted, Passive, Temporarily Out of Service for %d minutesset: error parsing value "%s" as an integer STA %s: rateset idle %d seconds in network %d seconds ASSOCIATED AUTHORIZED state:%s%s%s BRCM ABCAP WME PS APSD_BE APSD_BK APSD_VI APSD_VO N_CAP flags 0x%x:%s%s%s%s%s%s%s%s%s AUTHENTICATEDvendorid 0x%x deviceid 0x%x radiorev 0x%x chipnum 0x%x chiprev 0x%x corerev 0x%x boardid 0x%x boardvendor 0x%x boardrev %s driverrev 0x%x ucoderev 0x%x bus 0x%x wl_rm_requestp%s: no measurement requests specified %s: could not parse "%s" as an int for the token %s: could not parse "%s" as an int for duration %s: could not parse "%s" as an int for channel %s: could not parse "%s" as a measurement type Measurement Report: token %d, length %d | IncapableRPI Report : %s ParallelLateRefusedflags : 0x%02x (%s) token : %4d (a)channel : %4d %s start tsf: 0x%x:%08x duration : %4d TU %3d Power <= %3d: %3d < Power <= %3d: %3d < Power : Basic Report : %d CCABasic bits: 0x%08x flags : 0x%02x Carrier Fraction: %d / 255 Error: partial report element, %d report bytes remain, element claims %d %s/0x%xWPA2%s/NONE0x%02x%02x%02x/0x%02x%s/AES%s/WEP40%s/TKIP%s/WEP104%02xPref 0x%x: len = %d Pref BAND: <%d extra bytes in pref data> Pref WPA: len = %d %d ACP Specs U:M:Any%s-NONE <%d extra bytes> Pref RSSIlen = %d 0x%x AUTO (no preference) 0x%x Use ASSOC_PREFER value 0x%x 5 GHz 0x%x 2.4 GHz 12b/gstawme_ac_staadvertised for STAwme_ac_apbebkacmaifsnecwmaxecwmintxopfor STAAC Parameters %s Warning: AC params out of order%s: raw: ACI 0x%x ECW 0x%x TXOP 0x%x dec: aci %d acm %d aifsn %d ecwmin %d ecwmax %d txop 0x%x eff: CWmin %d CWmax %d TXop %dusec for APvivoacm value must be 1|0 Can't work with AP parameters on STA unexpected param %s txop %d out of range (%d-%d) aifsn %d out of range (%d-%d) ecwmax %d out of range (%d-%d) ecwmin %d out of range (%d-%d) wme_qosinfoMax SP Length = %d, APSD: BE=%d BK=%d VI=%d VO=%d %s: STA only %s: Invalid parameter Discard oldest first: BE=%d BK=%d VI=%d VO=%d Lifetime for access class '%s' is %dms Too few arguments vndr_ieError parsing OUI arg Ignoring data bytes for IE of length %dInvalid OUI Invalid packet flag 0x%x (%d) IE length should be <= %d IE length should be >= %d Data bytes should be specified for IE of length %dPlease specify all the data bytes for this IE memory alloc failure delTotal IEs %d IE index = %d -----------------Pkt Flg = 0x%x Length = %d OUI = %02x:%02x:%02x Error %d getting IOVar %s %d txframetxbytetxretranstxerrorrxframerxbyterxerrortxprshorttxdmawartxnobuftxnoassoctxchittxcmissresettxserrtxphyerrtxphycrstxfaild11_txfrag %d d11_txmulti %d d11_txretry %d d11_txretrie %d d11_txrts %d d11_txnocts %d d11_txnoack %d d11_txfrmsnt %d rxcrcrxnobufrxnondatarxbaddsrxbadcmrxduprxfragerrrxruntrxgiantrxnoscbrxbadprotorxbadsrcmacd11_rxfrag %d d11_rxmulti %d d11_rxundec %d rxctlrxbaddarxfilterrxuflo: txallfrmtxrtsfrmtxctsfrmtxackfrmtxdnlfrmtxbcnfrmtxtplunfltxfunfl: tkipmicfailltkipicverrtkipcntrmsrtkipreplayccmpfmterrccmpreplayccmpundecfourwayfailwepundecwepicverrdecsuccessrxundecrxfrmtoolongrxfrmtooshrtrxinvmachdrrxbadfcsrxbadplcprxcrsglitchrxstrtrxdfrmucastmbssrxmfrmucastmbssrxcfrmucastrxrtsucastrxctsucastrxackucastrxdfrmocastrxmfrmocastrxcfrmocastrxrtsocastrxctsocastrxdfrmmcastrxmfrmmcastrxcfrmmcastrxbeaconmbssrxdfrmucastobssrxbeaconobssrxrsptmoutbcntxcanclrxf0ovflrxf1ovflrxf2ovfltxsfovflpmqovflrxcgprqfrmrxcgprsqovfltxcgprsfailtxcgprssucprs_timeoutrxnackfrmsconstxnacktxglitch_nacktxbursttxphyerrortxchanrej Incorrect version of counters struct: expected %d; got %d %s: tx frames: %d bytes: %d failed frames: %d failed bytes: %d rx frames: %d bytes: %d failed frames: %d failed bytes: %d tx frames time expired: %d foward frames: %d bytes: %d diag test %d failed(error code %d) diag test %d passed Usage: %s testindex[1-4] nphy_rssiant ant%d = %d Usage: %s antenna_index[0-3] G711signalunknown command This command can only be executed on the STA wl cac_delts ver a b c where ver is the structure version where a is byte[0] of tsinfo (bits 0-7) where b is byte[1] of tsinfo (bits 8-15) where c is byte[2] of tsinfo (bits 16-23) wl cac_addts v a b c d e ... where d is the nominal MSDU size where e is the maximum MSDU size where f is the minimum service interval where g is the maximum service interval where h is the inactivity interval where i is the suspension interval where j is the minimum data rate where k is the mean data rate where l is the peak data rate unknown direction option count %d tsinfo 0x%02X 0x%02X 0x%02X TID %d User Prio %d Direction %d UNKNOWNTID %d %s tsinfo 0x%02x 0x%02x 0x%02x nom_msdu_size %d %s max_msdu_size %d min_srv_interval %d max_srv_interval %d inactivity_interval %d suspension_interval %d srv_start_time %d min_data_rate %d mean_data_rate %d peak_data_rate %d max_burst_size %d delay_bound %d min_phy_rate %d surplus_bw %d medium_time %d wl cac_tspec 0xaa 0xbb 0xcc where 0xaa is byte[0] of tsinfo (bits 0-7) where 0xbb is byte[1] of tsinfo (bits 8-15) where 0xcc is byte[2] of tsinfo (bits 16-23) PENDINGACCEPTEDfixed sizeREJECTED Incorrect version of TSPEC struct: expected %d; got %d TSPEC arg length too short: expected %d; got %d 0x%02x %s invalid %d args UTX 0x%02x URX 0x%02x DTX 0x%02x DRX 0x%02x Invaild DRX parameter: %s Invaild URX parameter: %s Invaild DTX parameter: %s Invaild UTX parameter: %s fifo %d size %d Total %d host addresses host_ip_entries = %d host_ip_overflow = %d arp_table_entries = %d arp_table_overflow = %d host_request = %d host_reply = %d host_service = %d peer_request = %d peer_request_drop = %d peer_reply = %d peer_reply_drop = %d peer_service = %d Cannot set arp stats, use 'wl arp_stats_clear' to clear the counterstx_summed = %d tx_iph_fill = %d tx_tcp_fill = %d tx_udp_fill = %d tx_icmp_fill = %d rx_iph_good = %d rx_iph_bad = %d rx_tcp_good = %d rx_tcp_bad = %d rx_udp_good = %d rx_udp_bad = %d rx_icmp_good = %d rx_icmp_bad = %d tx_tcp_errinj = %d tx_udp_errinj = %d tx_icmp_errinj = %d rx_tcp_errinj = %d rx_udp_errinj = %d rx_icmp_errinj = %d Cannot set toe stats, use 'wl toe_stats_clear' to clear the counterstxInvalid command name %s pktengrxwl_rxiqest%ddBm %ddBm %ddBm %s: could not parse "%s" as an int for the sample count %s: could not parse "%s" as an int for antenna (0, 1, 3) %s: sample count too large %d(10 <= x <= 16) %s: invalid antenna select %d 0XMask invalid format. Needs to start with 0xMask invalid format. Needs to be of even length#of patterns :%d Pattern %d: Offset :%d Masksize :%d Mask :0x PatternSize:%d Pattern :0xStarting offset not providedMask not providedPattern value not providedSet rifs error %d Set frameburst error %d %s: socket/proc/net/dev%s: Unrecognized command "%s", type -h for help %s: wl driver adapter not found r:wlwl_get_dev_type%02x:%02x:%02x:%02x:%02x:%02x%d.%d.%d.%d%d.%d%c%03x%sba%d%s%s%sulnl q v { € … Š  ” ™ ž £ ¨ ´ $<(P,d0x4Œ8 <´@Èd|hl¤p¸tÌxà|ô€„ˆ0ŒD•q™…™¡­¸8¼LÀ`ÄtȈÌœаÔÄØØ@—H—p—Œ—°—Ô—ô— (,<@HLTXdhtxŒœ ¨¬´¸ÌÐìðü $(04DHTXdhpt|€ˆŒ”˜ ¤¬°¸¼ÔØäèøü(,@DPTdhpt€„”œ ¬°ÀÄàäìðì ,0DH`dpt|€ˆŒ´¸ÈÌìàìð $(8<DHìXdhtxŒ˜œ¤¨´¸ÌÐØÜäèôø(,48@DLP`dx|˜œ¤¨°´¼ÀÈÌÔØäèðô  (,ì<HLX\dhx|„ˆ”¸¼ÜàìðüD$(04@D`dlpx|„ˆ”œ ì¬´¸ÀÄÌÐØÜäèðôü D(04DDLP\`hlD|ˆŒ´¸ÌÐØÜèì   ( , 4 8 @ D \ ` p t € „ ” œ   Ì Ð Ü à è ì ø ü    $ 4 8 L P \ ` l p | € ˆ Œ ” ˜ ¸ ¼ DÌ ä è ð ô     , 0 8 < D H P T \ ` l p ˆ Œ œ   ¬ ° ¼ À È Ì Ô Ø à ä ô ø   $ , 0 < @ H L l p D€ ˆ Œ   ¤ ° ´ ¼ À Ì Ð Ü à è ì ø ü    $ , 0 ì< P T \ ` ìh x | ” ˜ ¤ ¨ Ä È ì ð ø ü  $(8<DHTXhlx|ˆŒ˜œ¬°¸¼ÌÐ  (,8<TXdhpt€„œ ¼ÀÌÐðô $ì4<@HLTXlp„ˆ”œ °´ÐÔÜàèìôø$(8<dhpt€„Œœ ¬°ÈÌäèìô  (,8<DHTXhl|ty|y„y”y¤y°y¼yÈyÐyØyÜyäyìyôyüyz z@ z€üX=zzz # zPQ $z@P1€,z8z\*+p=#$$+X+'ÿÿÿÿ`+p+d@ÿÿÿÿ)|+È+DØÿÿÿÿÿÿÿÿÔ+,Ümëì ,,,Lïÿÿÿÿ-4,À-pÿÿÿÿ-È-.H¼,ÿÿÿÿ.0.tt·ÿÿÿÿ4.p.lqÿÿÿÿÈ|.ì.ÿÿÿÿÊ/\/ØûQRl/´/wx¸/0çÿÿÿÿÿÿÿÿ(0H0Ð"ÿÿÿÿyT0œ0Ð"ÿÿÿÿz¨0ø0DhÿÿÿÿÉ1P1ú…†X1Ô1ØûÜ1 2Põ¤¥,2¤2Øû¬2Ð2 iÿÿÿÿ Ø23HIÿÿÿÿ23¬5(êÿÿÿÿ´5T8(êÿÿÿÿ\8ü:01;(;./4;t;Ødõô|;<Æ3ÿÿÿÿœ<¼<ÆÿÿÿÿÌ<X=¨fÿÿÿÿÿÿÿÿ`=°=¨fÿÿÿÿÿÿÿÿ¸=>ˆ ÿÿÿÿ4><>|ÙÿÿÿÿH>d>H]Ùÿÿÿÿp> >´bÿÿÿÿ´>$?ܯÿÿÿÿ0?x?yÿÿÿÿ„?¬?st¼?@äzÿÿÿÿ<@¬@ø1GH´@lB¤67|BhC¤89tCÀC:;ÔC D0«¬DE¸¹E0Eº»DEtE¼½„E¬EÀEèE¾¿øE@FÀÁTFtFÕÿÿÿÿ€F¤Fˆ ÿÿÿÿÖ¸FÜFœ”STäF˜GèV¬GäGˆÒÿÿÿÿÿÿÿÿìG|Hìò„H¼IH„EFÀIHJijPJøJH„{|üJ”KŠ‹œKèK‡ÿÿÿÿðK$Lÿÿÿÿ\0LÀLÿÿÿÿ]ÈL\MÿÿÿÿJhMôM쇎üM”N°‰ŒÿÿÿÿœNÈNÈŠ´ÿÿÿÿÐNøNÿÿÿÿO@O‘’TOœO“”°O|P›œˆPèP‘‰ÿÿÿÿðPQt‹ÿÿÿÿ˜$QPQ mnXQœQ•ÿÿÿÿ°QàQ²³üQlR–—ˆRÐR²³äRPSop\S”Sž SÜSH„ŸÿÿÿÿèST¢ÿÿÿÿ$TPT¼ÿÿÿÿXT¨Tü$¸TèT|ÿÿÿÿÿÿÿÿôTU|ÿÿÿÿÿÿÿÿU8U|ÿÿÿÿÿÿÿÿHUhUòópUˆUž”U\VžhV@Wh¢ÿÿÿÿLW\W¨‘ÓÔlWÜWÚÛèWXÜÝX4X8X`XtnhXŒX˜uÿÿÿÿ˜X¼Xt¬ÿÿÿÿÌXðXøX$Ytn,YLYXY€Yt¬ÿÿÿÿY Y8r¬YÔYt¬ÿÿÿÿèYZœsÿÿÿÿZ0Zt¬ÿÿÿÿ@Z`ZæçdZŒZKLZÀZMNÈZØZÐ"öÿÿÿÿèZ[°£÷ÿÿÿÿ([X[°¤h[”[܆ÿÿÿÿ¤[Ì[܆ÿÿÿÿÜ[\¤¦ÿÿÿÿú \¼\|¨ÿÿÿÿüÄ\0]”©ÿÿÿÿ4]8^ÿÿÿÿþD^ˆ^,ÿÿÿÿ^|`Hÿÿÿÿ„`¬`h¸`Ü`d"ÎÍè`,a0axap$€aÌaØabä,,b cø/cŒc”Mÿÿÿÿœc¬ct¬ÿÿÿÿÀcÔcT2àc8dˆ ÿÿÿÿû@dTdÐ ÿÿÿÿ`d€dˆÿÿÿÿd¨d¬ÿÿÿÿ¼dØdXQÿÿÿÿède¬ÿÿÿÿ e e|ÿÿÿÿÿÿÿÿ,eXe$ÿÿÿÿdete¨8ÿÿÿÿ|eg„8ÿÿÿÿghhÌ8ÿÿÿÿph˜hD;ÿÿÿÿ hàh,Žÿÿÿÿèh i,Žÿÿÿÿ(i\i¬ÿÿÿÿhiti€i´iÀRÀijÀR jtjè;ÿÿÿÿ€j j`(ÿÿÿÿ¬jäj U×ØðjÔkùøàklCDl`l 'll˜låœlÀlØûÌlôlØûmmØû(m@mPÿÿÿÿHm°mt¬ÿÿÿÿÀmÜmèVämnèVÿÿÿÿ$n0nÄÄÿÿÿÿ8nHnDÎPn°n¼noÐWÿÿÿÿopÐWÿÿÿÿpqbÿÿÿÿq\q cÿÿÿÿhqÜq iÿÿÿÿìqrÈiÿÿÿÿ rÀsì>¬ ??( ÏÄ Öø ‹ô @ @  0 ‹ A8 Ad „€ „   ¶œ B¤ B¼ ¶¸ CÀ CÜ Ü !!,! 8!¬ H!T! šŒ! Ê|! D!D ! E¬!E´! Ê°! F¸!FÌ! šø! Êü!Íô! F"F(","X" d"t" Ê\" G|"G¨"Ð"Ô"ð" Ò# ¸0# ÃL# šŒ# ÖÌ#Ð#$ ¿$4$ …L$ àd$ ˜x$ ÒÄ$ Òü$%T% l%¬% ‹¤% H¼%HØ% „& š & I&I,&0&L& ùT&ùX&`&d& Ò„& ²€& Jˆ&J¬& ²¨& K´&KÀ& ‹¼& Ä& ''D' …H'X' `'t' …x'Œ' à˜' '¨' Ö¤' ¬'( Ò$( ( ((`(d( ( …´(À( ÒÈ(à()8) š4) LD)LT) ‹`)Mx) št) N„)N) ‹P) Mœ)M´) ‹°) OÀ)OÐ) ‹Ì) PÜ)Pì) ‹è) Qø)Q ** „`* ‹\* Ol*O|* ‹x* Rˆ*R°* Ò´*S¬* S¸*SØ* + ‹+ T+TH+ ‹,+ UT+U`+ ‹0+ Vh+Vˆ+ ä+ ‹ + W°+WÀ+ XÈ+XÌ+Xð+, Ò0, ‹,, Y<,Yl, ‹P, Zx,Z„, ‹T, VŒ,V¬,°,è, ‹ä, [ô,[- ‹- \,-\- E@-Eð! ÍD-Í - ]L-]- ÍP-Íl- „œ- -Ø- ¿$. ŸD. ´ . EL.Ep. “°. ¶. )¼.)Ì. ¶. ]Ø.]\/ Ëh/ ª`/ ^l/^´/ ËÀ/ ª¸/ _Ä/_Ü/ Ëä/ ªà/ `ì/`0000 ¿h0 ¶d0 Bl0Bˆ0 ¶„0 a”0a¨0 Öè0 Ò1 ß 1 „X1 `1Ä1 ËÌ1 ªÈ1 bÜ1bè1 Öø1ü142 ÒT2 ßl2 „ 2 ÒÌ2 ¶Ä2 ,Ð2,ì2 ¶è2 cø2c3 3`3 Ël3 Ød3 dp3d¼3 Öü3404 ¿”4 Æ 4eä4 ¨X5 ´4 e\5ex5 ã¬5 ˜Ì5 ËØ5 ªÐ5 fà5f\6 à|6 ãÌ6 ËØ6 ªÐ6 gä6gè6 Ëô6 ªì6 h7h7 Ë7 ª7 i7i 7$7H7 ¯x7 ¥È7 ÆÄ7 jÌ7jè7 Æä7 kì7k8 Æ8 l8ll8 Ëx8 ªp8 m€8m˜8œ8¸8 ÜÈ8 Ò9 šü8 n 9n9 o9o(9 ‹$9 p49pD9 ‹@9 qP9qˆ9 ÖÔ9 ‹Ð9 rà9rì9ð9$: Ÿˆ:Œ:¼: ÊÈ:°: sÐ:s¤: Ô:ì:ð:H; “l; ÊL; tˆ;tø;ü;d< Êt<u€< š¬< ʨ< v¼<vÔ< ÊP< uä<uð< š = šd= „p=t=¨= ¶¤= w¬=wÈ= Ö> ¶>  >(> ¶$> x4>xL> Ò> ‹Œ> ”>¨> „è> ‹ä> ð>ø> ‹ô> x?x? ‹? w?w??X? Òx? ‹t? *„?*À? ¶¼? Ä?Ü? Ö @ ¶@ $@H@ Üd@h@”@ ܼ@ ÜÜ@ ÖAATA \A`AÀA ÆT5 eÌAeðA ¿0B ¨pB ÆtBî”B à¸B ˜ÜB ÆØB yàByüB ÆøB zCz C ÆC {$C{@C Æhs>$s ?€s?¤s Ïìs ôs t t ¶ðr >$(` Æ\ ?h?„ Æ€ @ˆ@¸ ¸Ô ãàãØ äž Æ ž AžA8ž š4ž BDžBXž ‹Tž :dž:xž štž >„ž>ž”žÈž Üðž ÜŸ Ü8Ÿ Ü\Ÿ ¨œŸ ¨ÜŸ ¨  ¨\  Ü€  ܤ  ÜÈ  Üì  Ü¡ Ü4¡ ÜL¡ \¡„¡ œ¡Ø¡ ‹¼¡ Cä¡C¢ ‹ ¢ D¢D8¢ ‹(¢ ED¢Eh¢l¢ˆ¢ ¢”¢Œ¢ Ü¢£ ‹ü¢ F£F8£ ‹<£ GL£GP£ š„£ Œ£˜£ H £H°£´£Ô£ Òü£ Ò¤ š0¤ š,¤ I8¤I<¤ JL¤JT¤ ‹P¤ K`¤K„¤ LŒ¤L¤ M˜¤M°¤´¤ܤ Òà¤ñؤ ñä¤ñ<¥ Üt¥ ‹p¥ N€¥N¸¥ ÖॠšÜ¥ Oì¥Oü¥ Ò,¦ L4¦L<¦ ‹8¦ PH¦PX¦ J`¦Jh¦ šd¦ Mt¦Mˆ¦ š„¦ I”¦I¤¦¨¦è¦ ¶ä¦ Qì¦Q§ ¸4§ <§H§$g L§8§ T§\§ Ö¤§ ¶ § R¨§Rħ ¶À§ SȧSä§ ¶ৠTè§T¨ ‹¨ U¨U$¨ š ¨ V0¨VH¨ ‹@¨ :T¨:d¨ š`¨ Wp¨W|¨€¨¤¨ Ü´¨ šܨ Üì¨ šਠWô¨W © Ü© š© W$©W<© Öt© W|©W”©˜©¼© ÜÌ© šø© Üü© XªX ª š,ª †<ª š0ª YDªY`ª ‹\ª ZdªZtª |ª¤ª W¬ªWðªôª8« …D«L«T«X« ›„« ÒŒ«´« ‹°« [¸«[è« šä« \ô«\¬¬¬  ¬8¬ š@¬t¬x¬¬ ˜¬¬¬°¬ܬ àL­ …h­ ›À­ Ü­à­® ®<® Ò ®¤®Ø® ¿ô® ¯L¯ \¯x¯ ˜¼¯À¯ȯ Яܯ௰ ¿H° ÒP°l° t°p° ]x°]À° Òø° ê±ê± ^±^ ± ‹± _,±_8± áT± ‹P± ``±`l± ሱ ‹„± a”±a°± ‹¨± b¼±bà± ‹ر cì±c² ‹² d²d”² ‹Œ² eœ²e´² š°² fÀ²f̲ Ô²ô² „³ š ³ g³g<³ „X³ šT³ hd³h„³ „¤³ ‹ ³ i°³iÔ³ ‹ij jô³j´ „X´ Ë`´ ª\´ kp´k€´ lˆ´l˜´ m ´m¤´ ݬ´ÝÌ´ áè´ Òµ á$µ ‹ µ n0µnLµ ‹Dµ oXµo|µ ‹tµ pˆµp¬µ ‹¤µ q¸µqص ràµrèµ ‹äµ sôµs¶ ‹¶ t¶t¶ ÒX¶ u`¶ud¶ šŒ¶ ‹|¶ v”¶v· ‹· w·w0· š,· x<·xL· ‹X·yh· ‹Œ·z¤· ‹°·{Ä· ‹è·z¸ š ¸|8¸ ‹(¸ }L¸}\¸ šX¸ ~h¸~x¸ ‹„¸”¸ ‹¸¸z̸ „è¸ šä¸ €ô¸€¹ ‹t¸  ¹¹ ‹@¹zT¹ „„¹ ‹t¹ ¹À¹ ‹°¹ ‚̹‚ô¹ ƒü¹ƒº „º„ º ‹º …,º…Pº ‹Hº †dº†pº „Œº šˆº ‡˜º‡¤º ‹°ºyÀº ‹äºzøº ‹»{» ‹<»zP» „l» šh» ˆx»ˆ„» ‹H· y»y » ‹Ä»zØ» ‹ · {ä»{ø» ‹P· z¼zH¼L¼ˆ¼ ϼÏ€¼ ˜¼¼¼ ÒT½ ‹P½ ‰X½‰€½ Šˆ½Š½ ‹Œ½ ‹˜½‹¼½ Ľä½ ‹འêð½ê¾ „T¾ ‹P¾ Œ`¾Œ„¾ ‹t¾ G¾G´¾ “¿ „L¿ ‹H¿ X¿l¿ ‹h¿ Žx¿ŽŒ¿ ‹ˆ¿ ˜¿¬¿ ‹¨¿ ˜¸¿˜Ì¿ ‹È¿ ›Ø¿›ì¿ ‹è¿ ø¿ À ‹À ‘À‘,À ‹(À ’0À’HÀ ‹DÀ “TÀ“hÀ ÃÀÀ „ÜÀ ËäÀ ØàÀ ”ìÀ”Á ‹Á • Á•$Á(ÁPÁ ¿TÁtÁ Û|ÁÛxÁ „Á Á ‹œÁ –¬Á–äÁ ‹Ðc ÊðÁÊ š  ËÂËDÂHÂp Êl —|—˜Â¤Â šh °Â¼Â Ô ¿ä ªô Ëà ÐÃÐ Ã Ã,à ª0à ˜<Ø@à ‹4à ™HÙ\à é¤Ã š¬Ãš¨Ã °ÃÈà ªÄà ›ÔÛàà éüà ËÄ œ ÄœÄ Ä4Ä ú<Äú8Ä DÄ\Ä ªXÄ dÄhÄ ËlÄ Â”Ä Ë˜Ä ÂœÄ ž¬ÄžÄÄÈÄôÄ šðÄ ŸÅŸÅ ¨ Å (Å$Å 4ÅXÅ šœÅ ‹”Å   Å ÆÆ<Æ Æ ¿°Æ ë¼Æë´Æ ÐÆ\Ç dÇ¼Ç ‹¸Ç ¡ÀÇ¡È ¨8È ÒÈ Ë˜È ª”È í Èí¼È ËÄÈ ªÀÈ íÌÈíèÈ šäÈ ¢ô颃 šÉ £É£(É Ë0É ª,É í8ÉíXÉ šTÉ ¤dɤtÉ špÉ ¥€É¥ŒÉ ¢¬É š¨É ¦¸É¦ÄÉ ËÐÉ ªÈÉ œÔÉœìÉðÉ,Ê LÊ ¿¤Ê «Ø °Ê ÄÊ «èÊ «lÊ ìÊ Ë àË Ó,ËÓË 8ËPË ŒTË ålË é¨Ë Ó°ËÓ¬Ë ¼ËÔË šÜËšØË äËÌ Ë Ì ØÌ §Ì§,Ì ÒPÌ ËXÌ ØTÌ ¨`̨|Ì Ë„Ì ª€Ì œŒÌœ¤Ì¨ÌÈÌ àÌÍ Ö\Í`ÍˆÍ ¿¸Í ÐÍÎÎÎ $ÎDÎH΄Π©”ΩΠ˜ÎÄÎ ýÌÎýÈÎ ÐÎÏ Í ÏÍ(Ï ‹$Ï ª4ϪtÏ ¯”Ï ¥8Ð ÆÏ CDÐC´Ð šÐÐ EØÐEÜÐ ËèÐ ªàÐ «ìЫ@Ñ ‹<Ñ ¬HѬ°Ñ ý¼Ñý´Ñ ÀÑØÑ ­àÑ­äÑ ËðÑ ªèÑ ®ôÑ®Ò Ë(Ò ª Ò ¯0Ò¯DÒ ËPÒ ªHÒ °XÒ°dÒ ËpÒ ªhÒ ±tÒ±ˆÒŒÒðÒ àLÓ ˜hÓ ÏpÓÏlÓ tÓ Ó ¨ÓèÓ Ö,Ô ¿HÔ ¶¤Ó ²TÔ²hÔ ¶dÔ ³lÔ³ˆÔ ¶„Ô ´ŒÔ´¨Ô ¶¤Ô µ¬ÔµÜÔ ¶ØÔ €àÔ€üÔ ¶øÔ ÕÕ ¶Õ ¶ Õ¶<Õ ¶8Õ û@Õû\Õ ¶XÕ ·`Õ·|Õ ¦xÕ Ø€ÕØ¤Õ ¶ Õ Ø°ÕØÄÕ ¶ÀÕ ¸ÈÕ¸äÕ ¶àÕ ¹èÕ¹Ö ¦Ö æÖæ8Ö ¶4Ö º<ÖºtÖ Ö˜Ö ÖÄÖÏ¼Ö ÈÖðÖ Ö× Ö@× ¶<× »D×»h× ¶d× ¼l×¼Œ× Ë× Â˜× ª”× ½¤×½À× ¶¼× ¾Ä×¾ì× ¶è× ¿ø×¿Ø ËØ Â$Ø ªØ À,ØÀDØHØdØ ÏlØÏpØ Ü„Ø ŒØ¤Ø ‹ Ø ¨ØÜØ èØ Ù ,ÙÙ”ÙÀÙ ÈÙ ØÙ ÆÔÙ ÜÙôÙ ¨<Ú DÚXÚ hÚ¬Ú ´ÚÔÚ ‹ÐÚ ÁàÚÁüÚ ‹ðÚ ÂÛÂ,Û 4ÛLÛ ‹HÛ XÛhÛlÛØÛ àÛüÛ áÜÜ ‹Ü ÃÜÃ$ÜdÜ †„Ü ¯€Ü ˆÜ ¨Ü ¥hÝ tÝ”Þ ‹Þ ĘÞÄìÞ ËüÞ ªøÞ ß ðÞ Å ßÅ,ß Ë<ß ª8ß @ß 0ß ÆLßÆ`ß Ëpß ªlß tß dß Û€ßÛß Ë ß ªœß ¤ß ”ß Ú°ßÚÀß ËÌß ªÄß ÞÔßÞØß àß üß Ëà ªà ÇàÇà Ë à ªà È,àÈ0à Ë<à ª4à ÝHàÝLà ËXà ªPà É`àÉdà Ëpà ªhà Ê|àÊ€à ËŒà ª„à á”àá˜à Ë¤à ªœà à¬àà¼àÀàôà Êðà ËáË á Êá Ì(áÌ<á Ò\á Ò¨á Ƥá δáÎ$â ÒLâ Tâ|â ˆâ¸â š´â Äâäâ ìâã  ã€ã„ãÈã šÄã ŸÔãŸøã ¨,ä ‹$ä  0ä Dä Lädä lä„ä ‹€ä ä¸ä Àäìä ‹èä ÍðäÍå å,å û4åû0å Påå ¶Œå Ñ”åÑ°å ¶¬å Ò´åÒÌå ¨üå æ`æ hædæ „æœæ°æ š¬æ ѼæÑèæ šäæ ÒôæÒçç8ç ¸\ç šlç tçŒç ‹ˆç ÎçÎ´ç ¼çÐç ÃÜç ‹è ‹üç è0è Ï<èÏ`è ÐhèÐè”èìè ÞøèÞüèðè é$é ‹(éé ,éé 0é é Ñ8éÑhé Ÿœé ŸØé äéÜé ÞðéÞôéàé øé(ê,ê`ê ¶\ê èdêè„ê ¶€ê éˆêé¨ê ‹¤ê Ò°êÒ´ê Ìê ¿Üê ªüê ë$ë Ó,ëÓ8ë é¬ë ´ë°ë Ðëèë Ëìë ‘øë‘ì ìHì àDì ÔLìÔpì à°ì ˜í ˜4í ˜œí íÀí äíî ÖXî\î„î ¿´î Ôîïïï ,ïLïPïtï ¿¤ï ä¬ïä¨ï ¸ïÔï Üð Øð $ðDð Ö<ð øXðøð  ð”ð ¸ðÐð ËÔð ÕäðÕôðøð ñ <ñXñ Ò¼ñÀñøñ ¿ò  òtò „ò¤ò ˜ìòðòó î$óîó 4ópó à”ó ˜´ó ºÐó ‹Ìó ÖÜóÖðó ÖDôî8ô Lôhô º„ô ‹€ô ×ô× ô ÒlB îÌôî¼ô Ðôèô Ëðô ªìô †øô†õõ(õ 0õPõTõŒõ ¨õèõ çøõçìõ üõö ‹ö @$ö@8ö Dö \ö ‹Xö AdöAtö ö ‹Œö A˜öA¸ö „÷ “(÷ 0÷ ÷ ˜÷ ¬÷ ¶,ø Ë4ø ª0ø ØDøØTø ç`øçXø døxø Ÿ€ø ˜ø äø ðøàø çøøç<ù Lù8ù çTùçhù šdù ÙtùÙˆù Ëù ØŒù Ú˜ùÚ´ù Ø°ù Û¸ùÛÐù Øù Üù ªÔù ÜìùÜú „ú úHú ÏXúÏLú hú´úϬú ¸úøú ¶ôú üú û ÖDû Ò`û ä|û ¨´û ÀûÈûÏØûÜû ü ,üdü ·Ôü Üüøü äLý ¶Hý Pýtý €ýœý ¨ýÀý ¶¼ý Äýäý ôý þ ¨DþHþlþ Ú|þÚpþ ŒþØþÚÌþ àþüþ Ãÿ šLÿ Òhÿ ¸”ÿ ÖŒC ÚÈÿÚ¼ÿ Ðÿèÿìÿ  Õ,Õ$ 8„ šœ àÀ šØ à Ò0@ ‹< ÝLÝ\`” š ޜޠ à° ‹Ô ×à×Ø ä …  š@ HT Ò\€ ߈߬°Ü ÆØ ÖàÖü šø àà ã$ á,á0 ªX …\d ª„ àœ Ö ì Ë Ë  ââ$(Œ ã”ã˜ã ¸ ààü Ò  (” š ä äì Ü ‹ å$å8 š4 æDæX ‹T ç\ç| ‹x èˆè´ „Ô ‹Ð éàéø ‹ô êê ‹ ë(ë@ ‹< ìLìd ‹` íhí| „ˆŒÀ ¨ø ‹  0 ä\ îœî¬°ä ¨  ‹, 0  < T  ä€ ´  îÀ îÐ Ô   ¸,  š(  Ð8 Ðd  ÷l ÷p ÷x €  àŒ Ä  Òð  ‹ì  ïü ï  ‹  ð ð$  ß@  ‹<  ñL ñ\  ‹X  òh ò€  ͈ Í   ó¨ ó¸  ôÀ ôÈ  ‹Ä  õÔ õì  öô ö  ÷ ÷  ø$ ø4  ù< ùL  úT úd  ûl û|  ü„ ü”  ýœ ý¬  þ´ þ¼  ‹¸  ÿÈ ÿØ  à ä  Íì Íð  Íø Íü  Í Í  Í Í  Í Í  Í( Í,  Í4 Í8  Í@ ÍD  ÍL ÍP  ÍX Í\  Íd Íh l €  Ò   ‹œ  ¨ Ô  ‹Ð  à ð  ‹ì  ü   ‹ ( ‹$ 4D ‹@ P` ‹\ l| ‹x ˆ” •° ‹¬ ¼ Ì ‹È Ø è ‹ä ô  ‹  ,0l ¿p˜ àœò” ò ò´ô ü  ¯ø  4 ¥À Æ$ RÌRÜ Æ( SèSü Æø TT| ¥¨¸À ÖØ Ëè ªä ì Ü øŒ ˈ ” œ ª ¨Ä ËÀ Ì Ô ªÈ äè Ëø ªô ü ì   Ë $ , ª  4HL„ óŒóó”¨ Ò¬ ‹   4 <@ HÈ ÐØ ‹Ô Üü L TX” œè ðô$ ‹ (D ‹@ PÈ ÐØ ‹Ô äô ‹ð  ‹   ° ‹¬ !¼!Ô "Ü"à ‹ô ‹ð #ø# $$$ %,%4 ‹0 &8&D ]L]P 'X'p ‹l (|( ‹Œ )˜)À ‹¼ *Ì*à ‹Ü +ä+ü  ¹ $D –L–x ‹t ,ˆ,˜ ¹” œ´ -¼-Ä ‹À .È.ð ‹à /ü/ ‹ 0$0, ‹( 1<1L ‹H 2T2\ ‹X 3d3hl¤ ô¬ô°ô¸ü# Ìì à à< ñDñLñl Ÿ¬ ÖP& ´ Ò8'  , 4@ ‹8 4P4d „È ‹Ä 5Ð5ô ‹ì 44 „4 ‡d ‹` 6p6¸ ‹´ ¼à ‹Ü 7ä7ü ‹ø 88$ ‹  909D ‹< :H:l t „ –Œ–¤ ‹  ,¨,¼ „Ø ‹Ô ;ä;ü „  ‹  <$ <4  ¹0  8 T  ‹P  =` =l  „œ  „¸  ¹´  ¼ Ü  ¹Ø  à ø  -!-! ‹! >$!>> Ê > ‡>‡$>4> Ê0> ˆ@>ˆH>X> ÊT> ‰d>‰l>|> Êx> Šˆ>Š> > Êœ> ‹¬>‹´>Ä> ÊÀ> ŒÜ>Œä>ô> Êð> ??? Ê$?,?Žtp>4p ?ˆp?°p ÏHq Xqtq Æpq ðxqðq ˜q °q ‹¬q @¼q@èq ‹Ðq AðqAr „8r¬v>¼v ‹¸v ?Èv?Øv ‹Ôv @äv@ôv ‹ðv AwAw ‹ w BwB,w ‹(w C8wCHw ‹Dw DTwDdw ‹`w EpwE€w ‹|w FŒwFœw ‹˜w G¨wG¸w ‹´w HÄwHÔw ‹Ðw IàwIðw ‹ìw JüwJ x šx K,xK8x x? |H `X$ $Y+ X[2 ˆ^9 |`@ ¬`G cN ÔcU Td\ Ødc ej \iq ˜lx @m Hn† o p” Àsœ ´t¤ ˆu¬ x´ Œz¼ zÄ ”zÌ ˜zÔ ÈzÜ Ìzä Ðzì Ôzô àzü èz ìz { T{ ˆ{$ ´{, Ø{4 |< 0|D X|L ||T €|\ ˆ|d Œ|l |t ”|| œ|„ ¤|Œ ¬|” ´|œ À|¤ È|¬ Ì|´ Ô|¼ ä|Ä ð|Ì ü|Ô }Ü }ä }ì }ô 0}ü 4} `} l} €} ´}$ ¸}, Ô}4 ì}< ~D $~L P~T h~\ œ~d Ä~l Ü~t ü~| D„ xŒ „” Œœ ”¤ ˜¬ œ´  ¼ ¨Ä ¬Ì ¸Ô ÀÜ Ðä ìì ôô üü € € $€ 4€ D€$ T€, d€4 t€< ˆ€D €L ”€T ¨€\ ¸€d Ì€l Ø€t à€| Ü€„ 而 0” lœ ˜¤ œ¬ Ô´ ܼ ‚Ä ‚Ì H‚Ô |‚Ü ¤‚ä Ì‚ì Ђô Ø‚ü è‚,ƒ @ƒXƒpƒ$„ƒ, ƒ4¬ƒ<´ƒD¼ƒLăT̃\Ôƒdàƒlèƒtôƒ|üƒ„„Œ„”(„œ0„¤8„¬<„´t„¼¼„Äô„Ì…ÔX…ÜŒ…äÄ…ìü…ô0†üp†œ† Ô†‡D‡$p‡,x‡4|‡<œ‡D¤‡L¨‡T¼‡\ćdЇl؇tà‡|è‡„ð‡Œˆ”ˆœˆ¤,ˆ¬0ˆ´Dˆ¼\ˆÄpˆÌ„ˆÔ¤ˆÜ¼ˆäĈìЈô܈üäˆìˆ ôˆ ‰,‰$4‰,<‰4H‰<\‰Dp‰L„‰T¬‰\´‰d؉là‰tì‰|ø‰„ŠŒŠ”$Šœ4Š¤@Š¬PŠ´dŠ¼xŠÄ|ŠÌ¨ŠÔÀŠÜØŠäðŠìôŠôøŠü‹‹ ‹$‹0‹$8‹,D‹4P‹<X‹D`‹Lh‹Tp‹\t‹d‹l¸‹tè‹|ø‹„(ŒŒ\Œ”€ŒœœŒ¤´Œ¬ÐŒ´èŒ¼øŒÄÌLÔ\ÜœäÔìØôìüŽlŽ ˆŽ¨ŽàŽ$äŽ,èŽ4ìŽ<ðŽDøŽL T \,dll„t´|Є،ä”ôœø¤ü¬´¼ÄDÌhÔܸäÈìÔô ‘ü‘‘ ‘,‘L‘$T‘,\‘4d‘<l‘D‘L¬‘T°‘\´‘d¸‘l¼‘tБ|ä‘„’Œ0’”X’œ\’¤Œ’¬˜’´¬’¼Ì’Äì’Ì“ÔD“܈“ä´“ìì“ô”üL”ˆ” ””œ”Ì”$Ô”,D•4T•<„•D¤•L¨•T°•\È•dà•l–t –|–„0–ŒL–”T–œ\–¤d–¬x–´À–¼—ĘÌP˜Ôl˜Ü„˜ä¬˜ì¸˜ôؘü蘙 P™x™˜™$œ™,¤™4¨™<¬™DЙLð™T š\$šd<šlXšttš|Œš„”šŒ˜š”´šœÌš¤àš¬›´$›¼@›Äp›Ì„›Ô”›Ü¤›ä¸›ìÀ›ôÜ›üà›ä› ü›œDœ$pœ,Œœ4°œ<ÌœDÜœLT4\PdXl`tl|p„˜Œ¨”°œÌ¤è¬ž´ ž¼0žÄ\žÌˆžÔ˜žÜ´žäÈžìÔžôèžüøžŸ Ÿ Ÿ(Ÿ$8Ÿ,HŸ4PŸ<pŸDxŸLˆŸT˜Ÿ\¼ŸdÀŸlÌŸtèŸ| „8 Œ@ ”X œ˜ ¤Ä ¬Ü ´ô ¼ ¡Ä$¡Ì<¡Ô`¡Ü„¡ä¡ì¸¡ôä¡ü¢ ¢ (¢T¢ˆ¢$´¢,¼¢4À¢<Ä¢DÌ¢LÔ¢TÜ¢\ä¢dì¢lô¢tü¢|£„L£ŒP£”X£œ”£¤¤£¬È£´à£¼ø£Ä$¤ÌX¤Ôx¤Ü°¤äȤìü¤ô¥ü ¥¥ 4¥P¥x¥$¨¥,Ä¥4Ì¥<Ô¥Dè¥Lü¥T<¦\`¦dl¦l„¦tÀ¦|̦„즌§”(§œD§¤§¬ܧ´ì§¼ ¨Ä,¨Ì<¨ÔH¨ÜP¨äX¨ìl¨ô|¨üˆ¨´¨ ä¨ð¨ü¨$©,,©48©<D©DT©L\©Td©\l©dp©l|©tˆ©|”©„ ©Œ¨©”Ì©œÜ©¤ì©¬ü©´ ª¼ªÄ,ªÌ<ªÔLªÜ`ªäpªì€ªôªü¬ª°ª ت «@«$p«, «4Ì«<ЫDÜ«Là«Tð«\ü«d¬l ¬t$¬|4¬„8¬ŒL¬”d¬œx¬¤€¬¬˜¬´°¬¼ȬÄЬÌì¬Ôð¬Ü­ä­ì4­ô€­üˆ­­ ˜­°­¸­$Ä­,Ì­4Ø­<à­Dø­L®T$®\0®dT®ld®th®|l®„p®Œx®” ®œ´®¤À®¬è®´¯¼$¯Ä0¯Ì@¯ÔD¯ÜH¯äL¯ìP¯ô\¯üp¯|¯ €¯„¯ˆ¯$¯,˜¯4 ¯<¨¯D°¯LįTä¯\ °dP°l|°t„°|ˆ°„Œ°Œ¤°”Ì°œä°¤±¬$±´D±¼d±Äp±Ì¤±Ô´±Ü̱äü±ì$²ô8²ü@²X² €²²°²$̲,è²4³<L³Dd³Lh³Tx³\ˆ³dœ³l¬³t¼³|س„ø³Œð³”´œ´¤´¬´´$´¼,´Ä4´Ì@´ÔL´ÜT´ä`´ìh´ôp´üx´€´ Œ´˜´ ´$à´,µ4$µ<,µD8µL@µTHµ\Pµd\µldµtlµ|tµ„€µŒŒµ”¼µœĵ¤̵¬ص´äµ¼ðµÄüµÌ¶Ô¶Ü ¶ä,¶ì8¶ôD¶üT¶ `¶ l¶ x¶ „¶$ ¶, œ¶4 ¨¶< ´¶D À¶L ̶T Ô¶\ ä¶d ô¶l ·t ·| ·„ $·Œ ,·” <·œ L·¤ X·¬ d·´ p·¼ |·Ä ˆ·Ì ”·Ô  ·Ü ¬·ä ¸·ì Ä·ô зü Ü·!ì· !ü·! ¸!¸$!$¸,!0¸4!<¸)T˜àJ)¬|U)”†@\)Ì™¤k)r)ƒ)ˆ)L“€‘)–)ˆ ¢)©)¬,ð¶)½)Àš4Ì)Ô)Û)¤ Xç)í)ù)ÿ)˜•d**wlu.cwl_versionwl_listwl_voidwl_outwl_radiowlu_dumpwlu_srwritewlu_srdumpwl_nvdumpwl_nvsetwl_nvgetwl_revinfowl_msglevelwl_print_deprecatewl_rate_mratewl_phy_ratewl_bssidwl_bss_maxwl_channelwl_cur_mcssetwl_dump_chanspecswl_chanspecwl_tssiwl_txpwrwl_txpwr1wl_get_txpwr_limitwl_attenwl_regwl_macregwl_gpiooutwl_ampdu_tidwl_ampdu_send_addbawl_ampdu_send_delbawl_var_voidwl_dpt_denywl_dpt_endpointwl_plcphdrwl_rateparamwl_wepstatuswl_primary_keywl_addwepwl_rmwepwl_keyswl_tscwl_wsec_testwl_bsscfg_intwl_iov_macwl_macwl_deauth_rcwl_wsecwl_wpa_authwl_set_pmkwl_scanwl_iscanwl_spectwl_dump_networkswl_statuswl_dump_chanlistwl_channels_in_countrywl_get_current_powerwl_get_instant_powerwl_evmwl_ratesetwl_band_elmwl_sup_ratesetwl_countrywl_varstrwl_joinwl_ssidwl_maclistwl_bandwl_bandlistwl_phylistwl_get_pktcntwl_upgradewl_gmodewl_rssiwl_phy_rssi_antwl_radar_argswl_dfs_statuswl_interferewl_offload_cmpntwl_toe_statswl_hostipwl_arp_statswl_wds_wpa_role_oldwl_wds_wpa_rolewl_maclist_1wl_measure_reqwl_send_quietwl_send_csawl_rm_requestwl_rm_reportwl_join_prefwl_assoc_prefwl_wme_ac_reqwl_wme_apsd_stawl_wme_dpwl_wme_counterswl_lifetimewl_sta_infowl_test_tssiwl_test_tssi_offswl_nphy_rssiantwl_var_getandprintstrwl_chan_infowl_add_iewl_del_iewl_list_iewl_randwl_otpwwl_bitvec128wl_counterswl_assoc_infowl_auto_channel_selwl_bsscfg_enablewl_diagwl_var_setintandprintstrwl_nratewl_cacwl_tslistwl_tspecwl_caldumpwl_antselwl_txfifo_szwl_rxiqwl_rifswl_pktengwl_wowl_patternac_namesarpoe_cmpnttoe_cmpntether_bcastwsec_testnqdBm_to_mW_mapwl_msgswc_cmdschan_infonull_flags.2bufrate_string2intwl_printrateetoa_buf.4wl_var_getbufwl_parse_ratesetwl_cfg_optioniptoa_buf.3wl_scan_prepwlu_parse_tlvswlu_bcmpwl_rsn_ie_parse_infowl_rsn_ie_decode_cntrswl_rsn_ie_dumpdump_bss_infoparse_wepwl_var_setbufwl_txpwr_range_printwl_txpwr_array_printwl_qdbm_to_mwwl_mw_to_qdbmwlc_cntry_abbrev_to_countrywl_var_getwl_iovar_mkbufwl_iovar_getbufwl_iovar_getwl_iovar_getintverstr.1wl_iovar_setbufwl_iovar_setwl_iovar_setintwl_bssiovar_mkbufwl_bssiovar_setbufwl_bssiovar_setwl_bssiovar_setintwl_bssiovar_getbufwl_bssiovar_getwl_bssiovar_getintauth_mode.0wl_join_pref_print_cipher_suitewl_vndr_iewl_pattern_atoh$LC529$LC588$LC696$LC532$LC536$LC538$LC550$LC552$LC558$LC560$LC564$LC600$LC602$LC604$LC610$LC612$LC614$LC644$LC646$LC648$LC650$LC654$LC656$LC672$LC674$LC698$LC700$LC708$LC710$LC712$LC720$LC730$LC736$LC774$LC854$LC862$LC886$LC900$LC902$LC904$LC916$LC922$LC926$LC932$LC934$LC952$LC972$LC980$LC990$LC994$LC996$LC1006$LC1012$LC1014$LC1022$LC1061$LC1062$LC1064$LC1063$LC1065$LC1066$LC1067$LC1068$LC1069$LC1071$LC1070$LC1072$LC1073$LC1074$LC1075$LC1076$LC1077$LC1078$LC1079$LC1080$LC1081$LC1082$LC1083$LC1084$LC1092$LC1093$LC1094$LC1090$LC1091$LC1095$LC1096$LC1089$LC1088$LC1087$LC1086$LC1085$LC1097$LC1098$LC1099$LC1102$LC1100$LC1101$LC1104$LC1103$LC1115$LC1106$LC1114$LC1108$LC1105$LC1116$LC1111$LC1112$LC1110$LC1113$LC1109$LC1107$LC1119$LC1120$LC1121$LC1122$LC1117$LC1118$LC1123$LC1124$LC1125$LC1127$LC1126$LC1128$LC1130$LC1129$LC1131$LC1132$LC1133$LC1134$LC1142$LC1135$LC1143$LC1144$LC1136$LC1138$LC1139$LC1140$LC1141$LC1137$LC1145$LC1146$LC1147$LC1148$LC1149$LC1150$LC1153$LC1151$LC1152$LC1154$LC1155$LC1156$LC1157$LC1158$LC1160$LC1161$LC1159$LC1162$LC1163$LC1164$LC1165$LC1166$LC1167$LC1169$LC1170$LC1171$LC1168$LC1172$LC1173$LC1175$LC1174$LC1176$LC1177$LC1183$LC1184$LC1186$LC1192$LC1196$LC1199$LC1201$LC1187$LC1188$LC1189$LC1179$LC1198$LC1200$LC1182$LC1197$LC1193$LC1195$LC1194$LC1191$LC1185$LC1178$LC1180$LC1181$LC1190$LC1202$LC1205$LC1215$LC1239$LC1206$LC1216$LC1207$LC1210$LC1213$LC1212$LC1211$LC1209$LC1208$LC1232$LC1233$LC1234$LC1235$LC1237$LC1236$LC1238$LC1226$LC1230$LC1231$LC1218$LC1221$LC1224$LC1223$LC1222$LC1220$LC1219$LC1225$LC1217$LC1227$LC1228$LC1229$LC1214$LC1242$LC1245$LC1241$LC1243$LC1240$LC1244$LC1246$LC1249$LC1250$LC1251$LC1252$LC1253$LC1254$LC1255$LC1266$LC1268$LC1271$LC1269$LC1272$LC1273$LC1275$LC1276$LC1277$LC1265$LC1264$LC1263$LC1262$LC1261$LC1260$LC1259$LC1258$LC1257$LC1256$LC1247$LC1248$LC1270$LC1274$LC1285$LC1286$LC1287$LC1280$LC1282$LC1284$LC1283$LC1281$LC1290$LC1289$LC1291$LC1292$LC1297$LC1296$LC1295$LC1294$LC1293$LC1298$LC1300$LC1299$LC1301$LC1302$LC1303$LC1304$LC1305$LC1306$LC1307$LC1308$LC1310$LC1309$LC1311$LC1313$LC1312$LC1314$LC1315$LC1318$LC1319$LC1317$LC1316$LC1320$LC1321$LC1322$LC1323$LC1324$LC1326$LC1325$LC1327$LC1328$LC1329$LC1330$LC1332$LC1333$LC1334$LC1335$LC1336$LC1337$LC1338$LC1339$LC1340$LC1341$LC1342$LC1343$LC1344$LC1345$LC1346$LC1347$LC1348$LC1349$LC1350$LC1351$LC1357$LC1358$LC1354$LC1352$LC1356$LC1359$LC1355$LC1353$LC1360$LC1361$LC1363$LC1362$LC1364$LC1365$LC1366$LC1369$LC1371$LC1372$LC1373$LC1367$LC1374$LC1375$LC1370$LC1368$LC1376$LC1377$LC1378$LC1379$LC1380$LC1382$LC1381$LC1383$LC1384$LC1385$LC1386$LC1387$LC1388$LC1389$LC1399$LC1400$LC1398$LC1402$LC1404$LC1403$LC1405$LC1401$LC1407$LC1406$LC1408$LC1410$LC1411$LC1412$LC1413$LC1414$LC1415$LC1409$LC1416$LC1417$LC1418$LC1420$LC1419$LC1422$LC1449$LC1448$LC1451$LC1452$LC1453$LC1454$LC1455$LC1456$LC1457$LC1458$LC1459$LC1460$LC1461$LC1421$LC1331$LC1450$LC1423$LC1424$LC1425$LC1426$LC1429$LC1427$LC1430$LC1431$LC1433$LC1434$LC1435$LC1436$LC1437$LC1438$LC1439$LC1444$LC1445$LC1446$LC1447$LC1462$LC1463$LC1428$LC1432$LC1440$LC1441$LC1442$LC1443$LC1466$LC1467$LC1468$LC1475$LC1472$LC1471$LC1470$LC1469$LC1473$LC1465$LC1474$LC1464$LC1476$LC1477$LC1479$LC1481$LC1484$LC1482$LC1483$LC1480$LC1485$LC1486$LC1487$LC1488$LC1494$LC1491$LC1489$LC1490$LC1492$LC1493$LC1496$LC1495$LC1497$LC1500$LC1501$LC1499$LC1498$LC1502$LC1503$LC1504$LC1505$LC1506$LC1507$LC1508$LC1509$LC1512$LC1513$LC1510$LC1515$LC1516$LC1517$LC1518$LC1511$LC1519$LC1520$LC1514$LC1521$LC1522$LC1524$LC1532$LC1529$LC1530$LC1528$LC1527$LC1526$LC1525$LC1534$LC1535$LC1537$LC1539$LC1540$LC1538$LC1541$LC1542$LC1543$LC1544$LC1545$LC1547$LC1546$LC1554$LC1553$LC1555$LC1556$LC1557$LC1559$LC1560$LC1561$LC1562$LC1563$LC1564$LC1566$LC1568$LC1565$LC1567$LC1569$LC1570$LC1571$LC1572$LC1573$LC1574$LC1575$LC1576$LC1577$LC1578$LC1579$LC1580$LC1583$LC1584$LC1581$LC1586$LC1587$LC1588$LC1589$LC1590$LC1591$LC1592$LC1593$LC1594$LC1585$LC1582$LC1595$LC1596$LC1597$LC1598$LC1599$LC1600$LC1601$LC1602$LC1603$LC1604$LC1605$LC1606$LC1608$LC1613$LC1609$LC1611$LC1610$LC1612$LC1615$LC1621$LC1624$LC1618$LC1619$LC1622$LC1623$LC1625$LC1626$LC1628$LC1630$LC1629$LC1631$LC1632$LC1639$LC1636$LC1637$LC1638$LC1616$LC1620$LC1617$LC1634$LC1627$LC1635$LC1633$LC1646$LC1640$LC1641$LC1647$LC1644$LC1642$LC1643$LC1645$LC1648$LC1668$LC1651$LC1650$LC1657$LC1658$LC1659$LC1662$LC1663$LC1665$LC1660$LC1666$LC1667$LC1649$LC1652$LC1653$LC1656$LC1654$LC1655$LC1670$LC1671$LC1672$LC1673$LC1675$LC1678$LC1676$LC1685$LC1686$LC1689$LC1691$LC1693$LC1695$LC1697$LC1680$LC1677$LC1681$LC1682$LC1683$LC1684$LC1679$LC1687$LC1688$LC1690$LC1674$LC1699$LC1698$LC1692$LC1694$LC1696$LC1701$LC1702$LC1700$LC1703$LC1704$LC1705$LC1706$LC1717$LC1715$LC1713$LC1710$LC1707$LC1708$LC1709$LC1711$LC1712$LC1714$LC1718$LC1719$LC1720$LC1721$LC1722$LC1723$LC1724$LC1725$LC1728$LC1727$LC1729$LC1730$LC1731$LC1732$LC1733$LC1734$LC1735$LC1736$LC1737$LC1738$LC1739$LC1740$LC1741$LC1742$LC1743$LC1744$LC1745$LC1746$LC1747$LC1748$LC1749$LC1750$LC1751$LC1752$LC1753$LC1754$LC1755$LC1756$LC1757$LC1758$LC1759$LC1760$LC1761$LC1762$LC1763$LC1764$LC1765$LC1766$LC1767$LC1768$LC1769$LC1770$LC1771$LC1772$LC1773$LC1774$LC1775$LC1776$LC1777$LC1778$LC1779$LC1780$LC1781$LC1782$LC1783$LC1784$LC1785$LC1786$LC1787$LC1788$LC1789$LC1790$LC1791$LC1792$LC1793$LC1794$LC1795$LC1796$LC1797$LC1798$LC1799$LC1800$LC1801$LC1802$LC1803$LC1804$LC1805$LC1806$LC1807$LC1808$LC1809$LC1810$LC1811$LC1812$LC1813$LC1814$LC1815$LC1816$LC1817$LC1818$LC1819$LC1820$LC1821$LC1822$LC1823$LC1824$LC1825$LC1826$LC1827$LC1726$LC1828$LC1829$LC1830$LC1831$LC1833$LC1834$LC1832$LC1836$LC1835$LC1839$LC1840$LC1838$LC1837$LC1856$LC1843$LC1844$LC1845$LC1846$LC1842$LC1847$LC1848$LC1849$LC1850$LC1851$LC1852$LC1853$LC1854$LC1855$LC1841$LC1857$LC1858$LC1868$LC1869$LC1870$LC1871$LC1873$LC1874$LC1875$LC1876$LC1877$LC1878$LC1879$LC1880$LC1881$LC1882$LC1883$LC1884$LC1885$LC1886$LC1859$LC1860$LC1861$LC1862$LC1865$LC1866$LC1872$LC1867$LC1863$LC1864$LC1887$LC1888$LC1889$LC1891$LC1893$LC1895$LC1896$LC1892$LC1894$LC1890$LC1897$LC1898$LC1899$LC1900$LC1901$LC1902$LC1903$LC1904$LC1905$LC1906$LC1907$LC1908$LC1909$LC1910$LC1911$LC1912$LC1913$LC1914$LC1915$LC1916$LC1917$LC1918$LC1919$LC1920$LC1921$LC1922$LC1923$LC1924$LC1925$LC1926$LC1927$LC1928$LC1929$LC1930$LC1931$LC1933$LC1935$LC1932$LC1934$LC1936$LC1941$LC1942$LC1937$LC1939$LC1938$LC1940$LC1943$LC1944$LC1945$LC1949$LC1950$LC1951$LC1952$LC1946$LC1947$LC1948$LC1954$LC1953wlu_cmd.cwlu_iov.cwlu_linux.csyserrwl_ioctlwl_find_cmd$LC0$LC1$LC2$LC8$LC7$LC3$LC4$LC6$LC5bcmutils.ccrc32_tablecrc16_tablecrc8_tablebcmwifi.cputcharstrcpywf_chspec_atonbcm_next_tlvioctlwl_iptoahndcrc16printfstdout_gp_dispbcm_ether_ntoawl_varcmdmemmovesnprintfbcm_bitcount__ctype_bwl_hexdumpbcm_brev_strfgetsbcm_ctypememcpyperrorputstolowerfeofmalloccmd_usagestrtoulbcmdumpfieldssocketwl_printlasterrorfflushbcmstrstrminioptstrncasecmphndcrc8strtolwl_cmds_usagefprintfstrcatprintfbigfreq2channelwl_checkminiopt_initbcm_ether_atoeferrorstrstrbcm_parse_tlvsstrncmpstrncpystrcasecmpwl_intwl_ether_atoememcmpwl_format_ssidfreadwc_cmd_checkfopenbcm_ip_ntoamemsetmainwl_dump_raw_ieav0wl_ether_etoafclosewl_atoipstrcmpwl_usagewl_varintwl_optionsprintfstderrwl_cmdsstrsepint_fmtfputcbcm_strtoulbcmstrcatwl_getbcm_qdbm_to_mwbcm_mkiovarbcmstrncatwl_setbcm_mw_to_qdbmfwrite__errno_locationexithndcrc32atoicntry_namesstrspndump_ratesetstrlenwf_chspec_ntoatoupperstrchrwl_printintfputswl_cmd_initclosebcm_parse_ordered_tlvsfreebcm_atoi